BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0751 (721 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC24H6.09 |gef1||RhoGEF Gef1|Schizosaccharomyces pombe|chr 1||... 27 2.7 SPAC22F3.13 |tsc1||hamartin|Schizosaccharomyces pombe|chr 1|||Ma... 26 4.7 >SPAC24H6.09 |gef1||RhoGEF Gef1|Schizosaccharomyces pombe|chr 1|||Manual Length = 753 Score = 27.1 bits (57), Expect = 2.7 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +1 Query: 583 NPKLISLKMVAQLTLIFTGYCPMKETAIYSIIVFGEEK 696 N LI L+ ++++ I+TGYC ++ +++ II EK Sbjct: 396 NLGLIFLESLSEIGQIYTGYC-NRQDSVFKIITKWREK 432 >SPAC22F3.13 |tsc1||hamartin|Schizosaccharomyces pombe|chr 1|||Manual Length = 899 Score = 26.2 bits (55), Expect = 4.7 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -2 Query: 699 RLFFPKHNNRIDCSFLHGAVASEYEG*LGNHFQGNQF 589 +L+ KHN +I SF ++++ +G LG H + F Sbjct: 362 KLYASKHNFQIRYSFNQELLSTKSDGLLGRHLAHSNF 398 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,903,900 Number of Sequences: 5004 Number of extensions: 32576 Number of successful extensions: 104 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 104 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 337208592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -