BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0750 (789 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein ... 27 0.50 AY745205-1|AAU93472.1| 91|Anopheles gambiae cytochrome P450 pr... 24 6.2 AY146760-1|AAO12075.1| 313|Anopheles gambiae odorant-binding pr... 24 6.2 AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 24 6.2 AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CY... 24 6.2 AF393487-1|AAL60412.1| 304|Anopheles gambiae odorant binding pr... 24 6.2 >AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein protein. Length = 168 Score = 27.5 bits (58), Expect = 0.50 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +3 Query: 240 QGGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 371 QGG Q S+G+G+ +P + G G +SG +FGN +GG Sbjct: 121 QGG-GQGGIPSFGSGQQNGGVPFL-GNGQGQSGFPSFGNGQQGG 162 >AY745205-1|AAU93472.1| 91|Anopheles gambiae cytochrome P450 protein. Length = 91 Score = 23.8 bits (49), Expect = 6.2 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +1 Query: 229 YCVSKEAGHKPVPNHGVPDVLLPE 300 Y + ++ H P P PD LPE Sbjct: 34 YAIQRDPDHYPDPERFDPDRFLPE 57 >AY146760-1|AAO12075.1| 313|Anopheles gambiae odorant-binding protein AgamOBP31 protein. Length = 313 Score = 23.8 bits (49), Expect = 6.2 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 162 GAHTSGPGQ*CSRFYVQELEAALLR 236 G +T+ G SRFYV++LE LR Sbjct: 199 GLYTTESGIHLSRFYVRDLEVNDLR 223 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 23.8 bits (49), Expect = 6.2 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -3 Query: 373 RPPRHMLPKAP*PDLWVPPPRTRGIRATARP 281 RPP H P W+ PP R +TA P Sbjct: 93 RPPWHPRPPFGGRPWWLRPPFHRPTTSTAAP 123 >AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CYP6P3 protein. Length = 509 Score = 23.8 bits (49), Expect = 6.2 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +1 Query: 229 YCVSKEAGHKPVPNHGVPDVLLPE 300 Y + ++ H P P PD LPE Sbjct: 411 YAIQRDPDHYPDPERFNPDRFLPE 434 >AF393487-1|AAL60412.1| 304|Anopheles gambiae odorant binding protein 1 protein. Length = 304 Score = 23.8 bits (49), Expect = 6.2 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 162 GAHTSGPGQ*CSRFYVQELEAALLR 236 G +T+ G SRFYV++LE LR Sbjct: 199 GLYTTESGIHLSRFYVRDLEVNDLR 223 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 819,008 Number of Sequences: 2352 Number of extensions: 17109 Number of successful extensions: 55 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82744797 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -