BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0749 (823 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81146-3|CAB03524.1| 496|Caenorhabditis elegans Hypothetical pr... 28 9.3 Z81113-5|CAB03282.3| 404|Caenorhabditis elegans Hypothetical pr... 28 9.3 AF164430-1|AAF82632.1| 404|Caenorhabditis elegans LIS-1 protein. 28 9.3 >Z81146-3|CAB03524.1| 496|Caenorhabditis elegans Hypothetical protein K10D11.5 protein. Length = 496 Score = 27.9 bits (59), Expect = 9.3 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = +2 Query: 185 ATVGASITTCHVLTLNYVSVVFHA*NVNHLYVAKVVIEWSIFVRLT 322 A V S TT + L N N N L+ V + WS VRLT Sbjct: 30 APVDTSTTTWYPLNFNETEPPLFPNNFNCLFNIMVPVGWSAVVRLT 75 >Z81113-5|CAB03282.3| 404|Caenorhabditis elegans Hypothetical protein T03F6.5 protein. Length = 404 Score = 27.9 bits (59), Expect = 9.3 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = -3 Query: 320 LVERKWTIQSLLSRRINDLHFK-HEIQR 240 ++E+KWT L R++NDL K E QR Sbjct: 48 ILEKKWTTVLRLQRKVNDLESKLQESQR 75 >AF164430-1|AAF82632.1| 404|Caenorhabditis elegans LIS-1 protein. Length = 404 Score = 27.9 bits (59), Expect = 9.3 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = -3 Query: 320 LVERKWTIQSLLSRRINDLHFK-HEIQR 240 ++E+KWT L R++NDL K E QR Sbjct: 48 ILEKKWTTVLRLQRKVNDLESKLQESQR 75 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,277,814 Number of Sequences: 27780 Number of extensions: 348798 Number of successful extensions: 650 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 641 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 650 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2029935014 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -