BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0749 (823 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 23 2.6 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 3.4 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 23.4 bits (48), Expect = 2.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -3 Query: 818 PLRTPLLSHASGHKLNSLNYFNVRCL*CGSTYLNK*INK 702 PLR+ L + KL + Y + C TYL+K I K Sbjct: 130 PLRSRLSPIFTSGKLKEMFYLIIECSLNLETYLDKLIEK 168 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 3.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 487 HNNTSAT*MSHNQT*VLLYNGCP 419 H+ S + M H + + L NGCP Sbjct: 362 HHTASESFMKHYENEMRLRNGCP 384 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,885 Number of Sequences: 438 Number of extensions: 4585 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26217432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -