BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0738 (401 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_1012 + 13207907-13207990,13209196-13209280,13209402-132101... 27 4.2 06_03_1226 - 28541522-28541755,28543095-28543740,28544017-28545575 27 5.6 01_06_0425 + 29264714-29266135 27 5.6 09_06_0187 + 21433842-21433887,21434504-21435246,21435437-214354... 27 7.3 07_01_0057 + 431084-431105,431149-431297,431380-431526,431622-43... 26 9.7 02_02_0043 + 6310311-6310317,6310791-6310865,6311694-6311934,631... 26 9.7 >03_02_1012 + 13207907-13207990,13209196-13209280,13209402-13210186, 13210262-13210462,13210580-13210690,13211105-13211487, 13211594-13211702,13211786-13211866,13212088-13212156, 13212379-13212467,13212619-13212780,13212859-13212916, 13213143-13213373,13213516-13213662,13213779-13214333, 13214562-13214819,13215096-13215203,13215760-13215854, 13215946-13216102,13216466-13216666,13217542-13217670, 13218292-13218567 Length = 1457 Score = 27.5 bits (58), Expect = 4.2 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -1 Query: 176 FLSKDDAQPASQGQSQTWMTLLKCNVLGQCLKTFLP 69 ++ D+AQ SQ W TLL N + L T P Sbjct: 652 YMVLDEAQAIKSSSSQRWKTLLSFNCRNRLLLTGTP 687 >06_03_1226 - 28541522-28541755,28543095-28543740,28544017-28545575 Length = 812 Score = 27.1 bits (57), Expect = 5.6 Identities = 19/81 (23%), Positives = 31/81 (38%) Frame = +2 Query: 89 IALAHYTSTKSSRFATGLGTQAVHHLSTRTPWPGE*LVKSKYPSICKRKMLPQDDILIFD 268 +AL + K S+ G++ H L R+ + + +V + CK L D Sbjct: 439 MALGMLNTGKESKQMISAGSKCFHDLLGRSLFQDQIIVYDETIQSCKMHDLIHDLAQFVS 498 Query: 269 ER*FPFIKCTKQCFGLFISHV 331 E I C K F + H+ Sbjct: 499 ENEHAVISCEKTAFSKRVKHL 519 >01_06_0425 + 29264714-29266135 Length = 473 Score = 27.1 bits (57), Expect = 5.6 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 104 YTSTKSSRFATGLGTQAVHHLSTRTP 181 ++ T ++ FA LG A HHL+T P Sbjct: 3 WSETDAALFAAVLGHDAAHHLATTPP 28 >09_06_0187 + 21433842-21433887,21434504-21435246,21435437-21435484, 21435929-21436814,21436967-21437056,21437543-21438417 Length = 895 Score = 26.6 bits (56), Expect = 7.3 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -2 Query: 217 RILRLH*SFSWPRRSCRKMMHSLR 146 RI R H WP R +K+ HSLR Sbjct: 612 RICRQHGINRWPSRKIKKVDHSLR 635 >07_01_0057 + 431084-431105,431149-431297,431380-431526,431622-431752, 431791-431894,432949-433128,433481-433581,434030-434185, 434679-434731,434818-434875,435162-435282,436010-436215 Length = 475 Score = 26.2 bits (55), Expect = 9.7 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = -2 Query: 298 GAFN-KRESTFVEYQDVVLREHFSFTD*RIL 209 G+FN KR+ T++ DV+LR H+ F D +L Sbjct: 154 GSFNSKRQDTYLPSFDVILRLHY-FNDTLVL 183 >02_02_0043 + 6310311-6310317,6310791-6310865,6311694-6311934, 6312035-6312194,6312820-6312876 Length = 179 Score = 26.2 bits (55), Expect = 9.7 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 309 KHCLVHLIKGNQRSSNIKMSS 247 KHC +H++ G+ + SNI + S Sbjct: 57 KHCGLHIVHGDLKPSNILLDS 77 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,394,447 Number of Sequences: 37544 Number of extensions: 201489 Number of successful extensions: 370 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 368 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 370 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 694697784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -