BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0738 (401 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC103695-1|AAI03696.1| 466|Homo sapiens chitinase 1 (chitotrios... 31 1.4 U29615-1|AAC50246.1| 466|Homo sapiens chitotriosidase precursor... 31 1.9 BC105682-1|AAI05683.1| 466|Homo sapiens chitinase 1 (chitotrios... 31 1.9 BC105681-1|AAI05682.1| 466|Homo sapiens chitinase 1 (chitotrios... 31 1.9 BC105680-1|AAI05681.1| 466|Homo sapiens chitinase 1 (chitotrios... 31 1.9 BC069614-1|AAH69614.1| 454|Homo sapiens CHIT1 protein protein. 31 1.9 BC139920-1|AAI39921.1| 407|Homo sapiens CHIA protein protein. 30 2.5 BC139901-1|AAI39902.1| 407|Homo sapiens CHIA protein protein. 30 2.5 BC106910-1|AAI06911.1| 368|Homo sapiens chitinase, acidic protein. 30 2.5 BC047336-1|AAH47336.2| 368|Homo sapiens chitinase, acidic protein. 30 2.5 BC036339-1|AAH36339.2| 368|Homo sapiens chitinase, acidic protein. 30 2.5 AY911311-1|AAX81434.1| 315|Homo sapiens chitinase family protei... 30 2.5 AY911310-1|AAX81433.1| 315|Homo sapiens chitinase family protei... 30 2.5 AY825504-1|AAX54833.1| 430|Homo sapiens chitinase family protei... 30 2.5 AY789445-1|AAX81432.1| 315|Homo sapiens chitinase family protei... 30 2.5 AY789444-1|AAX81431.1| 368|Homo sapiens chitinase family protei... 30 2.5 AL513202-5|CAH70804.1| 405|Homo sapiens eosinophil chemotactic ... 30 2.5 AL513202-4|CAH70803.1| 476|Homo sapiens eosinophil chemotactic ... 30 2.5 AL513202-3|CAH70802.1| 420|Homo sapiens eosinophil chemotactic ... 30 2.5 AL356387-9|CAI19266.1| 405|Homo sapiens eosinophil chemotactic ... 30 2.5 AL356387-8|CAI19265.1| 476|Homo sapiens eosinophil chemotactic ... 30 2.5 AL356387-6|CAI19263.1| 420|Homo sapiens eosinophil chemotactic ... 30 2.5 AF290004-1|AAG60019.1| 476|Homo sapiens acidic mammalian chitin... 30 2.5 AB025009-1|BAA86981.1| 315|Homo sapiens novel member of chitina... 30 2.5 AB025008-1|BAA86980.1| 368|Homo sapiens novel member of chitina... 30 2.5 >BC103695-1|AAI03696.1| 466|Homo sapiens chitinase 1 (chitotriosidase) protein. Length = 466 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P+ + FY C GR + CP+ L F+ + C W Sbjct: 427 LYPNPRERSSFYSCAGGRLFQQSCPTGLVFSNSCKCCTW 465 >U29615-1|AAC50246.1| 466|Homo sapiens chitotriosidase precursor protein. Length = 466 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P+ + FY C GR + CP+ L F+ + C W Sbjct: 427 LYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTW 465 >BC105682-1|AAI05683.1| 466|Homo sapiens chitinase 1 (chitotriosidase) protein. Length = 466 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P+ + FY C GR + CP+ L F+ + C W Sbjct: 427 LYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTW 465 >BC105681-1|AAI05682.1| 466|Homo sapiens chitinase 1 (chitotriosidase) protein. Length = 466 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P+ + FY C GR + CP+ L F+ + C W Sbjct: 427 LYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTW 465 >BC105680-1|AAI05681.1| 466|Homo sapiens chitinase 1 (chitotriosidase) protein. Length = 466 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P+ + FY C GR + CP+ L F+ + C W Sbjct: 427 LYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTW 465 >BC069614-1|AAH69614.1| 454|Homo sapiens CHIT1 protein protein. Length = 454 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P+ + FY C GR + CP+ L F+ + C W Sbjct: 415 LYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTW 453 >BC139920-1|AAI39921.1| 407|Homo sapiens CHIA protein protein. Length = 407 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P N N F++CV G ++C + L F+ C+W Sbjct: 368 LYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 406 >BC139901-1|AAI39902.1| 407|Homo sapiens CHIA protein protein. Length = 407 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P N N F++CV G ++C + L F+ C+W Sbjct: 368 LYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 406 >BC106910-1|AAI06911.1| 368|Homo sapiens chitinase, acidic protein. Length = 368 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P N N F++CV G ++C + L F+ C+W Sbjct: 329 LYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 367 >BC047336-1|AAH47336.2| 368|Homo sapiens chitinase, acidic protein. Length = 368 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P N N F++CV G ++C + L F+ C+W Sbjct: 329 LYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 367 >BC036339-1|AAH36339.2| 368|Homo sapiens chitinase, acidic protein. Length = 368 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P N N F++CV G ++C + L F+ C+W Sbjct: 329 LYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 367 >AY911311-1|AAX81434.1| 315|Homo sapiens chitinase family protein V2 protein. Length = 315 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P N N F++CV G ++C + L F+ C+W Sbjct: 276 LYPVASNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 314 >AY911310-1|AAX81433.1| 315|Homo sapiens chitinase family protein V1 protein. Length = 315 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P N N F++CV G ++C + L F+ C+W Sbjct: 276 LYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 314 >AY825504-1|AAX54833.1| 430|Homo sapiens chitinase family protein 3 protein. Length = 430 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P N N F++CV G ++C + L F+ C+W Sbjct: 391 LYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 429 >AY789445-1|AAX81432.1| 315|Homo sapiens chitinase family protein 2 protein. Length = 315 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P N N F++CV G ++C + L F+ C+W Sbjct: 276 LYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 314 >AY789444-1|AAX81431.1| 368|Homo sapiens chitinase family protein 1 protein. Length = 368 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P N N F++CV G ++C + L F+ C+W Sbjct: 329 LYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 367 >AL513202-5|CAH70804.1| 405|Homo sapiens eosinophil chemotactic cytokine (CHIA) protein. Length = 405 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P N N F++CV G ++C + L F+ C+W Sbjct: 366 LYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 404 >AL513202-4|CAH70803.1| 476|Homo sapiens eosinophil chemotactic cytokine (CHIA) protein. Length = 476 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P N N F++CV G ++C + L F+ C+W Sbjct: 437 LYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 475 >AL513202-3|CAH70802.1| 420|Homo sapiens eosinophil chemotactic cytokine (CHIA) protein. Length = 420 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P N N F++CV G ++C + L F+ C+W Sbjct: 381 LYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 419 >AL356387-9|CAI19266.1| 405|Homo sapiens eosinophil chemotactic cytokine (CHIA) protein. Length = 405 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P N N F++CV G ++C + L F+ C+W Sbjct: 366 LYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 404 >AL356387-8|CAI19265.1| 476|Homo sapiens eosinophil chemotactic cytokine (CHIA) protein. Length = 476 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P N N F++CV G ++C + L F+ C+W Sbjct: 437 LYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 475 >AL356387-6|CAI19263.1| 420|Homo sapiens eosinophil chemotactic cytokine (CHIA) protein. Length = 420 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P N N F++CV G ++C + L F+ C+W Sbjct: 381 LYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 419 >AF290004-1|AAG60019.1| 476|Homo sapiens acidic mammalian chitinase precursor protein. Length = 476 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P N N F++CV G ++C + L F+ C+W Sbjct: 437 LYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 475 >AB025009-1|BAA86981.1| 315|Homo sapiens novel member of chitinase family protein. Length = 315 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P N N F++CV G ++C + L F+ C+W Sbjct: 276 LYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 314 >AB025008-1|BAA86980.1| 368|Homo sapiens novel member of chitinase family protein. Length = 368 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 22 LLPHEGNCNLFYYCVWGRKVLRHCPSTLHFNKVIQVCDW 138 L P N N F++CV G ++C + L F+ C+W Sbjct: 329 LYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNW 367 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 57,982,074 Number of Sequences: 237096 Number of extensions: 1129169 Number of successful extensions: 1976 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 1938 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1976 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2928276690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -