BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0732 (794 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_17755| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 >SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2429 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/51 (27%), Positives = 27/51 (52%) Frame = -2 Query: 325 YLEALVFNFTSRYVSSLIYLYVTMIIGNG*LTTLIVRLAFASTNAH*MNTL 173 ++E LVF ++ Y S++ YLY + G G I ++ + +H + +L Sbjct: 2038 FMEVLVFEPSNSYFSAVTYLYERLATGGGTTYRSIKTMSLYGSRSHGLQSL 2088 >SB_17755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 317 Score = 28.7 bits (61), Expect = 5.7 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -2 Query: 358 LVFDSSIFPYTYLEALVFNFTSRYVSSL 275 +VF +S+F YTY +FN+ + + S L Sbjct: 91 IVFSASVFSYTYTVVELFNYLNLFSSDL 118 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,666,355 Number of Sequences: 59808 Number of extensions: 401036 Number of successful extensions: 811 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 801 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2191792647 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -