BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0727 (732 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces... 27 2.8 SPCC306.03c |cnd2||condensin subunit Cnd2|Schizosaccharomyces po... 27 2.8 SPAC4F10.13c |mpd2||GYF domain|Schizosaccharomyces pombe|chr 1||... 27 3.6 SPCC736.14 |dis1||microtubule-associated protein Dis1 |Schizosac... 27 3.6 SPBC19C2.11c |||mitochondrial outer membrane protein |Schizosacc... 27 3.6 >SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1155 Score = 27.1 bits (57), Expect = 2.8 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = +1 Query: 538 ELGLPSRCDQRVLLRNFRNQQ---YRSGFHHLRFRIQ 639 E GL S CD L+NF N Q + G++ + IQ Sbjct: 296 ETGLSSTCDVNCSLQNFANYQDFYFSKGYNSYQIEIQ 332 >SPCC306.03c |cnd2||condensin subunit Cnd2|Schizosaccharomyces pombe|chr 3|||Manual Length = 742 Score = 27.1 bits (57), Expect = 2.8 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +2 Query: 176 EQSTLVEPPSSTAIGDSRLLIALL 247 +Q+ L+ PPSS+ GD+ LL A L Sbjct: 593 KQTPLLTPPSSSGFGDNLLLTARL 616 >SPAC4F10.13c |mpd2||GYF domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 992 Score = 26.6 bits (56), Expect = 3.6 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 490 PPVGEELDQWYRS*KYELGLP 552 P G ++ QWYR+ + LGLP Sbjct: 401 PFTGVDMHQWYRAGYFPLGLP 421 >SPCC736.14 |dis1||microtubule-associated protein Dis1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 882 Score = 26.6 bits (56), Expect = 3.6 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +2 Query: 533 NMNWVFLRGVTNAFCSEIFVINNIVQDSTICASGYNVTSQSTCQGDSGGGL 685 N++ V NAF + +F +Q S + AS NVTS++T G L Sbjct: 189 NLSITLYAWVGNAFKTHVFPQLKQIQVSDLEASFQNVTSRTTTGGHISNSL 239 >SPBC19C2.11c |||mitochondrial outer membrane protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 452 Score = 26.6 bits (56), Expect = 3.6 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -2 Query: 104 ILAPALTFSTKVRAGSADTTATPAIATRS 18 + +PA +S GS DTTA P+I RS Sbjct: 310 VSSPATQYSASDYLGSNDTTARPSIFGRS 338 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,849,676 Number of Sequences: 5004 Number of extensions: 58817 Number of successful extensions: 146 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 146 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 345237368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -