BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0727 (732 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0503 - 3596664-3596837,3597647-3598069,3598362-3598595,359... 30 1.6 12_01_0042 + 337131-337612,338727-338898,338996-339204,339414-33... 28 6.6 >06_01_0503 - 3596664-3596837,3597647-3598069,3598362-3598595, 3598720-3598993,3599390-3599523,3599572-3599634, 3599759-3599846,3599919-3599989,3600898-3601010, 3601836-3602004,3602580-3602671,3602819-3603295, 3603736-3604090 Length = 888 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 96 RQDRIRMGSRRRTVPLPAVTAHGEP*GSSQRLWSH 200 R+ +R+ RRR PLPA A P S ++WS+ Sbjct: 5 RESLVRLIGRRRRSPLPAALALAVPPSRSLQVWSN 39 >12_01_0042 + 337131-337612,338727-338898,338996-339204,339414-339572, 339914-340262 Length = 456 Score = 28.3 bits (60), Expect = 6.6 Identities = 18/57 (31%), Positives = 27/57 (47%) Frame = -1 Query: 630 EAQMVES*TILLITKISEQNALVTPRRKTQFIFSGAVPLVQFFPNRWQSDGNRRSCN 460 E QMV+ I L K++E + KT+ F+G+ P + N W D N + N Sbjct: 301 EVQMVDGYEIAL-KKLTEYLGANINKNKTRIFFAGSSPAHSWASN-WGGDDNNKCLN 355 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,348,102 Number of Sequences: 37544 Number of extensions: 447604 Number of successful extensions: 1105 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1064 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1105 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1921741964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -