BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0726 (757 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g18640.2 68414.m02324 3-phosphoserine phosphatase (PSP) nearl... 32 0.47 At1g18640.1 68414.m02323 3-phosphoserine phosphatase (PSP) nearl... 32 0.47 At1g30450.3 68414.m03722 cation-chloride cotransporter, putative... 30 1.4 At1g30450.2 68414.m03721 cation-chloride cotransporter, putative... 30 1.4 At1g30450.1 68414.m03720 cation-chloride cotransporter, putative... 30 1.4 At5g54820.1 68418.m06828 F-box family protein contains Pfam:PF00... 29 4.4 At5g25170.1 68418.m02984 expressed protein 28 5.8 At1g62260.1 68414.m07024 pentatricopeptide (PPR) repeat-containi... 28 5.8 At4g11530.1 68417.m01850 protein kinase family protein contains ... 28 7.7 At1g49740.1 68414.m05578 expressed protein similar to MAP3K-like... 28 7.7 >At1g18640.2 68414.m02324 3-phosphoserine phosphatase (PSP) nearly identical to 3-phosphoserine phosphatase GI:3759177 from [Arabidopsis thaliana] Length = 295 Score = 31.9 bits (69), Expect = 0.47 Identities = 10/35 (28%), Positives = 22/35 (62%) Frame = -3 Query: 392 NTLGYYDTLLDNSTLLDVWAEVDGMCYSYDAHILV 288 +TLG+ ++ + +LD+W V+ +C+ D+ + V Sbjct: 62 STLGHEGNIVPSKEILDLWRSVEAVCFDVDSTVCV 96 >At1g18640.1 68414.m02323 3-phosphoserine phosphatase (PSP) nearly identical to 3-phosphoserine phosphatase GI:3759177 from [Arabidopsis thaliana] Length = 295 Score = 31.9 bits (69), Expect = 0.47 Identities = 10/35 (28%), Positives = 22/35 (62%) Frame = -3 Query: 392 NTLGYYDTLLDNSTLLDVWAEVDGMCYSYDAHILV 288 +TLG+ ++ + +LD+W V+ +C+ D+ + V Sbjct: 62 STLGHEGNIVPSKEILDLWRSVEAVCFDVDSTVCV 96 >At1g30450.3 68414.m03722 cation-chloride cotransporter, putative similar to cation-chloride co-transporter GB:AAC49874 GI:2582381 from [Nicotiana tabacum], Cation-Chloride Cotransporter (CCC) Family Member, PMID:11500563 Length = 975 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 148 LKGSGSW*EQYQRTVGTIDSRWV 80 +KG W +YQR GTID W+ Sbjct: 767 IKGLDEWPNEYQRQYGTIDLYWI 789 >At1g30450.2 68414.m03721 cation-chloride cotransporter, putative similar to cation-chloride co-transporter GB:AAC49874 GI:2582381 from [Nicotiana tabacum], Cation-Chloride Cotransporter (CCC) Family Member, PMID:11500563 Length = 975 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 148 LKGSGSW*EQYQRTVGTIDSRWV 80 +KG W +YQR GTID W+ Sbjct: 767 IKGLDEWPNEYQRQYGTIDLYWI 789 >At1g30450.1 68414.m03720 cation-chloride cotransporter, putative similar to cation-chloride co-transporter GB:AAC49874 GI:2582381 from [Nicotiana tabacum], Cation-Chloride Cotransporter (CCC) Family Member, PMID:11500563 Length = 975 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 148 LKGSGSW*EQYQRTVGTIDSRWV 80 +KG W +YQR GTID W+ Sbjct: 767 IKGLDEWPNEYQRQYGTIDLYWI 789 >At5g54820.1 68418.m06828 F-box family protein contains Pfam:PF00646 F-box domain Length = 472 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +1 Query: 199 IAGSSRRSEPGEISYVHFALTIPNSLRRITT 291 ++ S RS G+ISY HF T+P S+ +TT Sbjct: 127 LSNPSWRSN-GDISYRHFMYTLPKSVYSLTT 156 >At5g25170.1 68418.m02984 expressed protein Length = 218 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 535 QILRRFGPGWWPRLRQY*LGCPCLLP 612 Q+ RR P W RL ++ L C C+LP Sbjct: 127 QLTRRSIPSWVNRLARFGLFCNCVLP 152 >At1g62260.1 68414.m07024 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 656 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 581 NTDLGAPAFFQNALVGIVSFGKSNANDIYPVVLTSIS 691 N +G AF NA + FG +N IYP +T +S Sbjct: 479 NAMIGGYAFHGNASEALNLFGSMKSNGIYPSHITFVS 515 >At4g11530.1 68417.m01850 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 931 Score = 27.9 bits (59), Expect = 7.7 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Frame = +1 Query: 85 ILNQWFQQCAGIVLTNYHYLSTATCFHGEF-----YDPAYRRIIA 204 +LN F L + Y+ST TCF+G F YD RRI++ Sbjct: 2 MLNTLFLPIFLFFLITFDYVSTQTCFNGYFKPNGTYDLNRRRILS 46 >At1g49740.1 68414.m05578 expressed protein similar to MAP3K-like protein kinase GB:CAB16796 GI:4006878 from [Arabidopsis thaliana] Length = 359 Score = 27.9 bits (59), Expect = 7.7 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 7/77 (9%) Frame = -3 Query: 476 HNEF-ELVEVAVRYTAAL----NGSSPSEQINKNTLGYYDTLLDNSTLLDVWA--EVDGM 318 HN F L EV+ +A L S + Q+N G+ + D D+W DG Sbjct: 84 HNSFARLGEVSRTGSAILAPTNQQDSITSQLNNGVRGFMLDMYDFQN--DIWLCHSFDGT 141 Query: 317 CYSYDAHILVVILLREF 267 C+++ A + +LREF Sbjct: 142 CFNFTAFQPAINILREF 158 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,984,973 Number of Sequences: 28952 Number of extensions: 409965 Number of successful extensions: 1066 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1032 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1066 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1682736544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -