BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0725 (742 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 23 4.0 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 5.3 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 5.3 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 21 9.2 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 9.2 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.6 bits (46), Expect = 4.0 Identities = 14/52 (26%), Positives = 23/52 (44%) Frame = +1 Query: 226 QNPTESDVKNVLFILNLMKGYLLRCFCQFTRPYRKHAVATLLMTLLRVCAIL 381 +N E D N ++ L LL ++P R H M ++++C IL Sbjct: 171 ENGKEFDCHN--YMSELTVDILLETAMGVSKPTRDHNAFEYAMAVMKMCDIL 220 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/25 (36%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +1 Query: 142 QEAFQLFDS-RGDGKIHVAQIGDAL 213 + +F ++ S +GDGK H+ G+ L Sbjct: 170 EPSFYIYPSLQGDGKFHLLPTGELL 194 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/25 (36%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +1 Query: 142 QEAFQLFDS-RGDGKIHVAQIGDAL 213 + +F ++ S +GDGK H+ G+ L Sbjct: 170 EPSFYIYPSLQGDGKFHLLPTGELL 194 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.4 bits (43), Expect = 9.2 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = +3 Query: 216 SFRTKSYRVRCEKCTLHLKPDERISFEVFLPIY 314 ++ +Y C+K ++ E+I V +PIY Sbjct: 99 NYNNNNYNNNCKKLYYNINYIEQIPVPVPVPIY 131 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 9.2 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -2 Query: 399 THCHLCQNGADPQ*SH*QCR 340 T C C+ G P +H CR Sbjct: 624 TQCISCRQGTVPDETHSACR 643 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,302 Number of Sequences: 438 Number of extensions: 3993 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -