BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0720 (613 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC11E3.08c |nse6||Smc5-6 complex non-SMC subunit Nse6|Schizosa... 25 8.6 SPAC26H5.13c |||DUF1753 family protein|Schizosaccharomyces pombe... 25 8.6 >SPAC11E3.08c |nse6||Smc5-6 complex non-SMC subunit Nse6|Schizosaccharomyces pombe|chr 1|||Manual Length = 522 Score = 25.0 bits (52), Expect = 8.6 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -2 Query: 315 GTNNHLKLNRTNILVCIH-L*KVLTFHNTLS 226 G+ +HL L+R + CIH L VL + NT S Sbjct: 435 GSTDHLLLSRCEVKDCIHRLFMVLYYLNTNS 465 >SPAC26H5.13c |||DUF1753 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 236 Score = 25.0 bits (52), Expect = 8.6 Identities = 12/44 (27%), Positives = 27/44 (61%) Frame = -2 Query: 180 SITNWRSGIE*IIGIFENSLVSMFQMIFLMNTTIINFIYVILFI 49 +I N SG+ I+ +F+NS S +Q++ +++ ++ ++ L I Sbjct: 39 AIINKVSGLYGIVSLFQNSDASPWQVLMYVSSVLMLILFSWLAI 82 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,119,896 Number of Sequences: 5004 Number of extensions: 38347 Number of successful extensions: 64 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 267622334 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -