BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0719 (750 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY330180-1|AAQ16286.1| 176|Anopheles gambiae odorant-binding pr... 28 0.35 AJ618924-1|CAF02003.1| 144|Anopheles gambiae odorant-binding pr... 28 0.35 AF393486-1|AAL60411.1| 162|Anopheles gambiae twelve cysteine pr... 27 0.47 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 26 1.4 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 26 1.4 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 26 1.4 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 26 1.4 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 25 2.5 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 24 5.8 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 23 7.6 AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 23 7.6 >AY330180-1|AAQ16286.1| 176|Anopheles gambiae odorant-binding protein AgamOBP54 protein. Length = 176 Score = 27.9 bits (59), Expect = 0.35 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 8/62 (12%) Frame = -2 Query: 335 EGAEDCSNTSSGTSYSHCRCTSTNEFGAESMSLVT--DVV------WKDRTAESCVGTAG 180 +GAEDCS++ TS H + T E +S+ L+ D+V + DR GTA Sbjct: 51 DGAEDCSSSVDETSEPHDKMMCTLECKLKSLGLLNGDDLVEAKVQEYIDRLEGDWKGTAK 110 Query: 179 TI 174 TI Sbjct: 111 TI 112 >AJ618924-1|CAF02003.1| 144|Anopheles gambiae odorant-binding protein OBP5470 protein. Length = 144 Score = 27.9 bits (59), Expect = 0.35 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 8/62 (12%) Frame = -2 Query: 335 EGAEDCSNTSSGTSYSHCRCTSTNEFGAESMSLVT--DVV------WKDRTAESCVGTAG 180 +GAEDCS++ TS H + T E +S+ L+ D+V + DR GTA Sbjct: 14 DGAEDCSSSVDETSEPHDKMMCTLECKLKSLGLLNGDDLVEAKVQEYIDRLEGDWKGTAK 73 Query: 179 TI 174 TI Sbjct: 74 TI 75 >AF393486-1|AAL60411.1| 162|Anopheles gambiae twelve cysteine protein 1 protein. Length = 162 Score = 27.5 bits (58), Expect = 0.47 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -2 Query: 335 EGAEDCSNTSSGTSYSHCRCTSTNEFGAESMSLV 234 +GAEDCS++ TS H + T E +S+ L+ Sbjct: 51 DGAEDCSSSVDETSEPHDKMMCTLECKLKSLGLL 84 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 25.8 bits (54), Expect = 1.4 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = -2 Query: 479 KVNSLESEEQQERHHKTEQTHSLRQGETQ 393 ++ L+ ++QQ+ HH+ +Q S Q ++Q Sbjct: 240 QLERLQQQQQQQTHHQQQQHPSSHQQQSQ 268 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 25.8 bits (54), Expect = 1.4 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = -2 Query: 479 KVNSLESEEQQERHHKTEQTHSLRQGETQ 393 ++ L+ ++QQ+ HH+ +Q S Q ++Q Sbjct: 240 QLERLQQQQQQQTHHQQQQHPSSHQQQSQ 268 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 25.8 bits (54), Expect = 1.4 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = -2 Query: 479 KVNSLESEEQQERHHKTEQTHSLRQGETQ 393 ++ L+ ++QQ+ HH+ +Q S Q ++Q Sbjct: 192 QLERLQQQQQQQTHHQQQQHPSSHQQQSQ 220 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 25.8 bits (54), Expect = 1.4 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = -2 Query: 479 KVNSLESEEQQERHHKTEQTHSLRQGETQ 393 ++ L+ ++QQ+ HH+ +Q S Q ++Q Sbjct: 240 QLERLQQQQQQQTHHQQQQHPSSHQQQSQ 268 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 25.0 bits (52), Expect = 2.5 Identities = 9/25 (36%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -1 Query: 204 RELCRDSRYHLCMGGY-CCKWSHQC 133 ++LC +++ L MGG+ KW+ C Sbjct: 882 KQLCEETKAALAMGGFPLRKWASNC 906 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 23.8 bits (49), Expect = 5.8 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +2 Query: 113 LPSSATLHWCDHLQQYPPIHRWYLLSLHSSLQCGPSRPH 229 LP SAT W Q+ P H ++ SS Q PH Sbjct: 19 LPYSATTGWYPSNYQHQPPHPQFIGDGESSPQPAMYYPH 57 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 23.4 bits (48), Expect = 7.6 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = -1 Query: 231 RCGLEGPHCRELCRDSRYHLCMGGYCCKWSHQCRVAE 121 RCGL G R +++ LC G + S R A+ Sbjct: 533 RCGLTGHKARSCQNEAKCALCGGAHHIGHSECARSAQ 569 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 23.4 bits (48), Expect = 7.6 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -1 Query: 135 CRVAEDGRPGCRGDQSG 85 C E G+ CRGD G Sbjct: 304 CAGGEKGKDSCRGDSGG 320 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 791,322 Number of Sequences: 2352 Number of extensions: 16511 Number of successful extensions: 65 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -