BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0719 (750 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X69908-1|CAA49533.1| 141|Homo sapiens protein ( H.sapiens gene ... 64 7e-10 X69907-1|CAA49532.1| 136|Homo sapiens P1 gene for c subunit of ... 64 7e-10 U09813-1|AAA78807.1| 142|Homo sapiens mitochondrial ATP synthas... 64 7e-10 M16453-1|AAA51806.1| 100|Homo sapiens ATP5A protein. 64 7e-10 D13119-1|BAA02421.1| 141|Homo sapiens ATP synthase subunit c pr... 64 7e-10 D13118-1|BAA02420.1| 136|Homo sapiens ATP synthase subunit c pr... 64 7e-10 CR533449-1|CAG38480.1| 136|Homo sapiens ATP5G1 protein. 64 7e-10 CR407601-1|CAG28411.1| 142|Homo sapiens ATP5G3 protein. 64 7e-10 BT007230-1|AAP35894.1| 136|Homo sapiens ATP synthase, H+ transp... 64 7e-10 BC106881-1|AAI06882.1| 142|Homo sapiens ATP synthase, H+ transp... 64 7e-10 BC020826-1|AAH20826.1| 141|Homo sapiens ATP5G2 protein protein. 64 7e-10 BC004963-1|AAH04963.1| 136|Homo sapiens ATP synthase, H+ transp... 64 7e-10 AC096649-1|AAX88970.1| 142|Homo sapiens unknown protein. 64 7e-10 M16439-1|AAA51804.1| 58|Homo sapiens ATP5A protein. 62 2e-09 AY714129-1|AAU94938.1| 4186|Homo sapiens anchor protein protein. 32 1.9 AF231023-1|AAF61929.1| 3312|Homo sapiens protocadherin Flamingo ... 32 1.9 AB011536-1|BAA32464.1| 1364|Homo sapiens MEGF2 protein. 32 1.9 S73849-1|AAB31735.1| 873|Homo sapiens very low density lipoprot... 32 2.5 L20470-1|AAA53684.1| 873|Homo sapiens very low density lipoprot... 32 2.5 D16532-1|BAA03969.1| 873|Homo sapiens very low density lipoprot... 32 2.5 D16493-1|BAA03945.1| 873|Homo sapiens very low density lipoprot... 32 2.5 DQ067198-1|AAY46157.1| 873|Homo sapiens very low density lipopr... 32 2.5 AL450467-4|CAH72453.1| 752|Homo sapiens very low density lipopr... 32 2.5 AL450467-2|CAH72454.1| 873|Homo sapiens very low density lipopr... 32 2.5 AK092381-1|BAC03874.1| 752|Homo sapiens protein ( Homo sapiens ... 32 2.5 AK000219-1|BAA91018.1| 420|Homo sapiens protein ( Homo sapiens ... 31 3.3 L22431-1|AAA61344.1| 873|Homo sapiens very low density lipoprot... 30 7.7 AL356104-4|CAH72941.1| 1037|Homo sapiens novel protein similar t... 30 7.7 AL158169-5|CAH70011.1| 1037|Homo sapiens novel protein similar t... 30 7.7 AK098809-1|BAC05419.1| 320|Homo sapiens protein ( Homo sapiens ... 30 7.7 >X69908-1|CAA49533.1| 141|Homo sapiens protein ( H.sapiens gene for mitochondrial ATP synthase c subunit (P2 form). ). Length = 141 Score = 63.7 bits (148), Expect = 7e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 95 FGSLIIGYARNPSLKQQLFSYAILGFALSE 124 >X69907-1|CAA49532.1| 136|Homo sapiens P1 gene for c subunit of human mitochondrial ATP protein. Length = 136 Score = 63.7 bits (148), Expect = 7e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 90 FGSLIIGYARNPSLKQQLFSYAILGFALSE 119 >U09813-1|AAA78807.1| 142|Homo sapiens mitochondrial ATP synthase subunit 9 precursor protein. Length = 142 Score = 63.7 bits (148), Expect = 7e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 96 FGSLIIGYARNPSLKQQLFSYAILGFALSE 125 >M16453-1|AAA51806.1| 100|Homo sapiens ATP5A protein. Length = 100 Score = 63.7 bits (148), Expect = 7e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 54 FGSLIIGYARNPSLKQQLFSYAILGFALSE 83 >D13119-1|BAA02421.1| 141|Homo sapiens ATP synthase subunit c precursor protein. Length = 141 Score = 63.7 bits (148), Expect = 7e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 95 FGSLIIGYARNPSLKQQLFSYAILGFALSE 124 >D13118-1|BAA02420.1| 136|Homo sapiens ATP synthase subunit c precursor protein. Length = 136 Score = 63.7 bits (148), Expect = 7e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 90 FGSLIIGYARNPSLKQQLFSYAILGFALSE 119 >CR533449-1|CAG38480.1| 136|Homo sapiens ATP5G1 protein. Length = 136 Score = 63.7 bits (148), Expect = 7e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 90 FGSLIIGYARNPSLKQQLFSYAILGFALSE 119 >CR407601-1|CAG28411.1| 142|Homo sapiens ATP5G3 protein. Length = 142 Score = 63.7 bits (148), Expect = 7e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 96 FGSLIIGYARNPSLKQQLFSYAILGFALSE 125 >BT007230-1|AAP35894.1| 136|Homo sapiens ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), protein. Length = 136 Score = 63.7 bits (148), Expect = 7e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 90 FGSLIIGYARNPSLKQQLFSYAILGFALSE 119 >BC106881-1|AAI06882.1| 142|Homo sapiens ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9) protein. Length = 142 Score = 63.7 bits (148), Expect = 7e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 96 FGSLIIGYARNPSLKQQLFSYAILGFALSE 125 >BC020826-1|AAH20826.1| 141|Homo sapiens ATP5G2 protein protein. Length = 141 Score = 63.7 bits (148), Expect = 7e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 95 FGSLIIGYARNPSLKQQLFSYAILGFALSE 124 >BC004963-1|AAH04963.1| 136|Homo sapiens ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) protein. Length = 136 Score = 63.7 bits (148), Expect = 7e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 90 FGSLIIGYARNPSLKQQLFSYAILGFALSE 119 >AC096649-1|AAX88970.1| 142|Homo sapiens unknown protein. Length = 142 Score = 63.7 bits (148), Expect = 7e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 FGSLIIGYARNPSLKQQLFSYAILGFALSE Sbjct: 96 FGSLIIGYARNPSLKQQLFSYAILGFALSE 125 >M16439-1|AAA51804.1| 58|Homo sapiens ATP5A protein. Length = 58 Score = 62.5 bits (145), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 FGSLIIGYARNPSLKQQLFSYAI+GFALSE Sbjct: 12 FGSLIIGYARNPSLKQQLFSYAIVGFALSE 41 >AY714129-1|AAU94938.1| 4186|Homo sapiens anchor protein protein. Length = 4186 Score = 32.3 bits (70), Expect = 1.9 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = -2 Query: 353 PGIADDEG---AEDCSNTSSGTSYSHCRCTSTNEFG 255 PG+A+ G A DC S++ CRC+ T FG Sbjct: 2556 PGLAEQHGVWTARDCELVHRNGSHARCRCSRTGTFG 2591 >AF231023-1|AAF61929.1| 3312|Homo sapiens protocadherin Flamingo 1 protein. Length = 3312 Score = 32.3 bits (70), Expect = 1.9 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = -2 Query: 353 PGIADDEG---AEDCSNTSSGTSYSHCRCTSTNEFG 255 PG+A+ G A DC S++ CRC+ T FG Sbjct: 2486 PGLAEQHGVWTARDCELVHRNGSHARCRCSRTGTFG 2521 >AB011536-1|BAA32464.1| 1364|Homo sapiens MEGF2 protein. Length = 1364 Score = 32.3 bits (70), Expect = 1.9 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = -2 Query: 353 PGIADDEG---AEDCSNTSSGTSYSHCRCTSTNEFG 255 PG+A+ G A DC S++ CRC+ T FG Sbjct: 538 PGLAEQHGVWTARDCELVHRNGSHARCRCSRTGTFG 573 >S73849-1|AAB31735.1| 873|Homo sapiens very low density lipoprotein receptor protein. Length = 873 Score = 31.9 bits (69), Expect = 2.5 Identities = 16/58 (27%), Positives = 26/58 (44%) Frame = -2 Query: 338 DEGAEDCSNTSSGTSYSHCRCTSTNEFGAESMSLVTDVVWKDRTAESCVGTAGTICVW 165 +E DC +T++ +YS + T+T E A S + + +E V GT W Sbjct: 743 EENGRDCQSTATTVTYSETKDTNTTEISATSGLVPGGINVTTAVSEVSVPPKGTSAAW 800 >L20470-1|AAA53684.1| 873|Homo sapiens very low density lipoprotein receptor protein. Length = 873 Score = 31.9 bits (69), Expect = 2.5 Identities = 16/58 (27%), Positives = 26/58 (44%) Frame = -2 Query: 338 DEGAEDCSNTSSGTSYSHCRCTSTNEFGAESMSLVTDVVWKDRTAESCVGTAGTICVW 165 +E DC +T++ +YS + T+T E A S + + +E V GT W Sbjct: 743 EENGRDCQSTATTVTYSETKDTNTTEISATSGLVPGGINVTTAVSEVSVPPKGTSAAW 800 >D16532-1|BAA03969.1| 873|Homo sapiens very low density lipoprotein receptor protein. Length = 873 Score = 31.9 bits (69), Expect = 2.5 Identities = 16/58 (27%), Positives = 26/58 (44%) Frame = -2 Query: 338 DEGAEDCSNTSSGTSYSHCRCTSTNEFGAESMSLVTDVVWKDRTAESCVGTAGTICVW 165 +E DC +T++ +YS + T+T E A S + + +E V GT W Sbjct: 743 EENGRDCQSTATTVTYSETKDTNTTEISATSGLVPGGINVTTAVSEVSVPPKGTSAAW 800 >D16493-1|BAA03945.1| 873|Homo sapiens very low density lipoprotein receptor protein. Length = 873 Score = 31.9 bits (69), Expect = 2.5 Identities = 16/58 (27%), Positives = 26/58 (44%) Frame = -2 Query: 338 DEGAEDCSNTSSGTSYSHCRCTSTNEFGAESMSLVTDVVWKDRTAESCVGTAGTICVW 165 +E DC +T++ +YS + T+T E A S + + +E V GT W Sbjct: 743 EENGRDCQSTATTVTYSETKDTNTTEISATSGLVPGGINVTTAVSEVSVPPKGTSAAW 800 >DQ067198-1|AAY46157.1| 873|Homo sapiens very low density lipoprotein receptor protein. Length = 873 Score = 31.9 bits (69), Expect = 2.5 Identities = 16/58 (27%), Positives = 26/58 (44%) Frame = -2 Query: 338 DEGAEDCSNTSSGTSYSHCRCTSTNEFGAESMSLVTDVVWKDRTAESCVGTAGTICVW 165 +E DC +T++ +YS + T+T E A S + + +E V GT W Sbjct: 743 EENGRDCQSTATTVTYSETKDTNTTEISATSGLVPGGINVTTAVSEVSVPPKGTSAAW 800 >AL450467-4|CAH72453.1| 752|Homo sapiens very low density lipoprotein receptor protein. Length = 752 Score = 31.9 bits (69), Expect = 2.5 Identities = 16/58 (27%), Positives = 26/58 (44%) Frame = -2 Query: 338 DEGAEDCSNTSSGTSYSHCRCTSTNEFGAESMSLVTDVVWKDRTAESCVGTAGTICVW 165 +E DC +T++ +YS + T+T E A S + + +E V GT W Sbjct: 622 EENGRDCQSTATTVTYSETKDTNTTEISATSGLVPGGINVTTAVSEVSVPPKGTSAAW 679 >AL450467-2|CAH72454.1| 873|Homo sapiens very low density lipoprotein receptor protein. Length = 873 Score = 31.9 bits (69), Expect = 2.5 Identities = 16/58 (27%), Positives = 26/58 (44%) Frame = -2 Query: 338 DEGAEDCSNTSSGTSYSHCRCTSTNEFGAESMSLVTDVVWKDRTAESCVGTAGTICVW 165 +E DC +T++ +YS + T+T E A S + + +E V GT W Sbjct: 743 EENGRDCQSTATTVTYSETKDTNTTEISATSGLVPGGINVTTAVSEVSVPPKGTSAAW 800 >AK092381-1|BAC03874.1| 752|Homo sapiens protein ( Homo sapiens cDNA FLJ35062 fis, clone OCBBF2019195, highly similar to VERY LOW-DENSITY LIPOPROTEIN RECEPTOR PRECURSOR. ). Length = 752 Score = 31.9 bits (69), Expect = 2.5 Identities = 16/58 (27%), Positives = 26/58 (44%) Frame = -2 Query: 338 DEGAEDCSNTSSGTSYSHCRCTSTNEFGAESMSLVTDVVWKDRTAESCVGTAGTICVW 165 +E DC +T++ +YS + T+T E A S + + +E V GT W Sbjct: 622 EENGRDCQSTATTVTYSETKDTNTTEISATSGLVPGGINVTTAVSEVSVPPKGTSAAW 679 >AK000219-1|BAA91018.1| 420|Homo sapiens protein ( Homo sapiens cDNA FLJ20212 fis, clone COLF1860. ). Length = 420 Score = 31.5 bits (68), Expect = 3.3 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -2 Query: 284 CRCTSTNEFGAESMSLVTDVVWKDRTAESCVG 189 CRC++ +F +L+ + +W T CVG Sbjct: 349 CRCSAEPDFSQNKQTLLVEFLWSHTTESMCVG 380 >L22431-1|AAA61344.1| 873|Homo sapiens very low density lipoprotein receptor protein. Length = 873 Score = 30.3 bits (65), Expect = 7.7 Identities = 15/58 (25%), Positives = 26/58 (44%) Frame = -2 Query: 338 DEGAEDCSNTSSGTSYSHCRCTSTNEFGAESMSLVTDVVWKDRTAESCVGTAGTICVW 165 +E DC +T++ +YS + T++ E A S + + +E V GT W Sbjct: 743 EENGRDCQSTATTVTYSETKDTNSTEISATSGLVPGGINVTTAVSEVSVPPKGTSAAW 800 >AL356104-4|CAH72941.1| 1037|Homo sapiens novel protein similar to mouse Jedi soluble isoform 736 protein protein. Length = 1037 Score = 30.3 bits (65), Expect = 7.7 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -1 Query: 225 GLEGPHCRELCRDSRYHLCMGGYCCKWSHQCRVAEDGRPGCRGDQ 91 G GP+C + CR GG C +++ QCR A PG GD+ Sbjct: 266 GFHGPNCSQECRCHN-----GGLCDRFTGQCRCA----PGYTGDR 301 >AL158169-5|CAH70011.1| 1037|Homo sapiens novel protein similar to mouse Jedi soluble isoform 736 protein protein. Length = 1037 Score = 30.3 bits (65), Expect = 7.7 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -1 Query: 225 GLEGPHCRELCRDSRYHLCMGGYCCKWSHQCRVAEDGRPGCRGDQ 91 G GP+C + CR GG C +++ QCR A PG GD+ Sbjct: 266 GFHGPNCSQECRCHN-----GGLCDRFTGQCRCA----PGYTGDR 301 >AK098809-1|BAC05419.1| 320|Homo sapiens protein ( Homo sapiens cDNA FLJ25943 fis, clone JTH10559. ). Length = 320 Score = 30.3 bits (65), Expect = 7.7 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -1 Query: 225 GLEGPHCRELCRDSRYHLCMGGYCCKWSHQCRVAEDGRPGCRGDQ 91 G GP+C + CR GG C +++ QCR A PG GD+ Sbjct: 67 GFHGPNCSQECRCHN-----GGLCDRFTGQCRCA----PGYTGDR 102 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,363,249 Number of Sequences: 237096 Number of extensions: 2418005 Number of successful extensions: 7714 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 7080 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7712 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 9015132854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -