BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0719 (750 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07671.1 68415.m00894 H+-transporting two-sector ATPase, C su... 44 1e-04 At3g26730.1 68416.m03342 zinc finger (C3HC4-type RING finger) fa... 29 2.5 At5g49470.2 68418.m06121 protein kinase family protein contains ... 29 4.4 At5g49470.1 68418.m06122 protein kinase family protein contains ... 29 4.4 At3g21810.1 68416.m02750 zinc finger (CCCH-type) family protein ... 29 4.4 At4g11170.1 68417.m01809 disease resistance protein (TIR-NBS-LRR... 28 7.6 At3g06620.1 68416.m00769 protein kinase family protein contains ... 28 7.6 >At2g07671.1 68415.m00894 H+-transporting two-sector ATPase, C subunit family protein similar to ATPase subunit 9 [Arabidopsis thaliana] GI:15215920; contains Pfam profile PF00137: ATP synthase subunit C Length = 85 Score = 43.6 bits (98), Expect = 1e-04 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +3 Query: 324 FGSLIIGYARNPSLKQQLFSYAILGFALSE 413 F SLI ARNPSL +Q F YAILGFAL+E Sbjct: 39 FSSLIHSVARNPSLAKQSFGYAILGFALTE 68 >At3g26730.1 68416.m03342 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 772 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 486 HYYCHPT*RFQCILSGVDSHGIECLETSP 572 H +C P Q +L+GVD+H ++C + P Sbjct: 262 HIFCFPC-ILQYLLTGVDNHKVDCFKRCP 289 >At5g49470.2 68418.m06121 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 834 Score = 28.7 bits (61), Expect = 4.4 Identities = 23/108 (21%), Positives = 54/108 (50%), Gaps = 4/108 (3%) Frame = -2 Query: 467 LESEEQQERHHKTEQTHSLRQGETQNGV*EQLLLEGGVPGIADDEGAEDCSNTSSGTSYS 288 + +E+Q+++ +++ HS++ E+Q E + P + + + ++TSS +S Sbjct: 410 VRNEQQKQQAYQSNSNHSVKS-ESQ--ACESIKASSNEP-MGYWSSSVNVNSTSSSSSCG 465 Query: 287 HCRCTSTNEFGAESMSLVTDVVWKDRTAESCV--GTAGTIC--VWVGT 156 + N+ +S L +++W+D T + G+ GT+ +W G+ Sbjct: 466 STSSSVMNKVDMDSDCLDYEILWEDLTIGEQIGQGSCGTVYHGLWFGS 513 >At5g49470.1 68418.m06122 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 483 Score = 28.7 bits (61), Expect = 4.4 Identities = 23/108 (21%), Positives = 54/108 (50%), Gaps = 4/108 (3%) Frame = -2 Query: 467 LESEEQQERHHKTEQTHSLRQGETQNGV*EQLLLEGGVPGIADDEGAEDCSNTSSGTSYS 288 + +E+Q+++ +++ HS++ E+Q E + P + + + ++TSS +S Sbjct: 123 VRNEQQKQQAYQSNSNHSVKS-ESQ--ACESIKASSNEP-MGYWSSSVNVNSTSSSSSCG 178 Query: 287 HCRCTSTNEFGAESMSLVTDVVWKDRTAESCV--GTAGTIC--VWVGT 156 + N+ +S L +++W+D T + G+ GT+ +W G+ Sbjct: 179 STSSSVMNKVDMDSDCLDYEILWEDLTIGEQIGQGSCGTVYHGLWFGS 226 >At3g21810.1 68416.m02750 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 437 Score = 28.7 bits (61), Expect = 4.4 Identities = 25/105 (23%), Positives = 44/105 (41%) Frame = -2 Query: 455 EQQERHHKTEQTHSLRQGETQNGV*EQLLLEGGVPGIADDEGAEDCSNTSSGTSYSHCRC 276 E Q + + H + Q T+ V + L+ G + +++ C N S SYS Sbjct: 277 ELQNTSSLSRKKHYVDQYTTKEPVEDGLIGRGEEEKVENEKKRPPCWNMLSSKSYSEEES 336 Query: 275 TSTNEFGAESMSLVTDVVWKDRTAESCVGTAGTICVWVGTAASGR 141 + N+ + S + WK R +GT+ T V + T+ + R Sbjct: 337 GAWNDEDTINRSSSKEDNWKRR--RFSIGTSATDKVILSTSMAAR 379 >At4g11170.1 68417.m01809 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1095 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +2 Query: 59 LIKTKCCLPPD*SPLQPGLPSSATLH--WCDHLQQYPPI 169 L++ CC + P LPS LH +C LQ +P I Sbjct: 682 LLEMSCCKKLEIIPTNINLPSLEVLHFRYCTRLQTFPEI 720 >At3g06620.1 68416.m00769 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 773 Score = 27.9 bits (59), Expect = 7.6 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 7/60 (11%) Frame = -2 Query: 314 NTSSGTSYSHCRCTST---NEFGAESMSLVTDVVWKDRTAESCV--GTAGTIC--VWVGT 156 N +S +S S C TS+ N+ +S L +++W D T V G+ GT+ +W G+ Sbjct: 457 NANSTSSASSCGSTSSSVMNKVDTDSEGLEYEILWDDLTIGEQVGQGSCGTVYHGLWFGS 516 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,901,223 Number of Sequences: 28952 Number of extensions: 332412 Number of successful extensions: 1028 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 985 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1027 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -