BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0717 (843 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharo... 27 3.3 SPBC23E6.01c ||SPBPJ758.01|RNA-binding protein, rrm type|Schizos... 26 5.8 SPBC16E9.02c |||CUE domain protein Cue5 |Schizosaccharomyces pom... 26 7.7 >SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 1811 Score = 27.1 bits (57), Expect = 3.3 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 115 YSNAQRNPITLTEDHFPTGNDPAAPFNNN 201 Y Q+N I L ++ PT N P P +N Sbjct: 874 YEEIQKNEIVLKDEQDPTSNFPEIPGTSN 902 >SPBC23E6.01c ||SPBPJ758.01|RNA-binding protein, rrm type|Schizosaccharomyces pombe|chr 2|||Manual Length = 473 Score = 26.2 bits (55), Expect = 5.8 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -3 Query: 652 KEVNVSNSNAQAVFVDTRSVGVNNFNVLSIVCSQ 551 +E ++S ++ ++FV S VN F+V S+ S+ Sbjct: 176 REKSISKASEYSIFVGDLSPNVNEFDVYSLFASR 209 >SPBC16E9.02c |||CUE domain protein Cue5 |Schizosaccharomyces pombe|chr 2|||Manual Length = 569 Score = 25.8 bits (54), Expect = 7.7 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +3 Query: 216 NNTRSQWHCYDDDNPIVKDAFLR 284 +N + ++DD P++KD F+R Sbjct: 132 DNDGDDYSFFEDDLPVIKDTFMR 154 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,505,413 Number of Sequences: 5004 Number of extensions: 73093 Number of successful extensions: 203 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 197 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 203 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 416455520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -