BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0714 (756 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ999006-1|ABJ99082.1| 282|Anopheles gambiae voltage-dependent ... 27 0.62 AY137768-1|AAN16031.1| 282|Anopheles gambiae porin protein. 27 0.62 AY082909-1|AAL89811.1| 282|Anopheles gambiae porin protein. 27 0.62 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 25 3.3 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 25 3.3 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 25 3.3 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 25 3.3 AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 pr... 24 4.4 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 24 4.4 U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 24 5.8 U50475-1|AAA93477.1| 207|Anopheles gambiae protein ( Anopheles ... 24 5.8 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 24 5.8 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 24 5.8 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 24 5.8 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 23 7.7 >DQ999006-1|ABJ99082.1| 282|Anopheles gambiae voltage-dependent anion channel protein. Length = 282 Score = 27.1 bits (57), Expect = 0.62 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +2 Query: 311 PPTFLDASQLATAILTSGYEFGSGKI-IYNKFKSVVSYAQS 430 PP++ D + A + GY FG K+ + K S V ++ S Sbjct: 3 PPSYSDLGKQARDVFNKGYHFGLWKLDVKTKTNSGVEFSTS 43 >AY137768-1|AAN16031.1| 282|Anopheles gambiae porin protein. Length = 282 Score = 27.1 bits (57), Expect = 0.62 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +2 Query: 311 PPTFLDASQLATAILTSGYEFGSGKI-IYNKFKSVVSYAQS 430 PP++ D + A + GY FG K+ + K S V ++ S Sbjct: 3 PPSYSDLGKQARDVFNKGYHFGLWKLDVKTKTNSGVEFSTS 43 >AY082909-1|AAL89811.1| 282|Anopheles gambiae porin protein. Length = 282 Score = 27.1 bits (57), Expect = 0.62 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +2 Query: 311 PPTFLDASQLATAILTSGYEFGSGKI-IYNKFKSVVSYAQS 430 PP++ D + A + GY FG K+ + K S V ++ S Sbjct: 3 PPSYSDLGKQARDVFNKGYHFGLWKLDVKTKTNSGVEFSTS 43 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 24.6 bits (51), Expect = 3.3 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -1 Query: 384 FPEPNSYPEVRIAVAS*LASKKVGGRRPISLATLMMCFPYNL 259 +P PN YP++ V + L +KV R S T +M Y L Sbjct: 14 YPTPNGYPQINGEVDAPLDFRKVESLRRNSTDTGIMDQQYCL 55 Score = 23.4 bits (48), Expect = 7.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 657 QQDPSSCHHQGAHRDH 704 QQ PSS H Q H+ H Sbjct: 268 QQHPSSQHQQPTHQTH 283 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 24.6 bits (51), Expect = 3.3 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -1 Query: 384 FPEPNSYPEVRIAVAS*LASKKVGGRRPISLATLMMCFPYNL 259 +P PN YP++ V + L +KV R S T +M Y L Sbjct: 14 YPTPNGYPQINGEVDAPLDFRKVESLRRNSTDTGIMDQQYCL 55 Score = 23.4 bits (48), Expect = 7.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 657 QQDPSSCHHQGAHRDH 704 QQ PSS H Q H+ H Sbjct: 268 QQHPSSQHQQPTHQTH 283 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 24.6 bits (51), Expect = 3.3 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -1 Query: 384 FPEPNSYPEVRIAVAS*LASKKVGGRRPISLATLMMCFPYNL 259 +P PN YP++ V + L +KV R S T +M Y L Sbjct: 14 YPTPNGYPQINGEVDAPLDFRKVESLRRNSTDTGIMDQQYCL 55 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 24.6 bits (51), Expect = 3.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 648 PHVQQDPSSCHHQGAHRDH 704 PHVQQ S HH H H Sbjct: 129 PHVQQHHPSVHHPAHHPLH 147 >AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 protein. Length = 505 Score = 24.2 bits (50), Expect = 4.4 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 76 FHRTVLHLHHRDEQLSGH 23 FH L+++ RD+ LSGH Sbjct: 103 FHDRGLYVNERDDPLSGH 120 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/47 (23%), Positives = 20/47 (42%) Frame = -1 Query: 438 GKSDWAYETTDLNLL*MIFPEPNSYPEVRIAVAS*LASKKVGGRRPI 298 G+S+W Y ++ PE NS ++ + +K V P+ Sbjct: 1508 GRSNWRYNNMRTGVISTAIPEANSEEDIVPPAPATATTKSVEREEPV 1554 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 23.8 bits (49), Expect = 5.8 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 10/52 (19%) Frame = +2 Query: 389 IYNKFKSVVSYAQSDLPLYTK----------KSIESASKLTAYDSLDSDVSN 514 +Y +F + Y + LP YT K + +T +D DSDVSN Sbjct: 422 LYERFMDLYYYFKRFLPSYTYEELNFNGVVIKDVTFDKLMTYFDYFDSDVSN 473 >U50475-1|AAA93477.1| 207|Anopheles gambiae protein ( Anopheles gambiae putativearylphorin precursor, mRNA, partial cds. ). Length = 207 Score = 23.8 bits (49), Expect = 5.8 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 10/52 (19%) Frame = +2 Query: 389 IYNKFKSVVSYAQSDLPLYTK----------KSIESASKLTAYDSLDSDVSN 514 +Y +F + Y + LP YT K + +T +D DSDVSN Sbjct: 90 LYERFMDLYYYFKRFLPSYTYEELNFNGVVIKDVTFDKLMTYFDYFDSDVSN 141 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.8 bits (49), Expect = 5.8 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 10/52 (19%) Frame = +2 Query: 389 IYNKFKSVVSYAQSDLPLYTK----------KSIESASKLTAYDSLDSDVSN 514 +Y +F + Y + LP YT K + +T +D DSDVSN Sbjct: 422 LYERFMDLYYYFKRFLPSYTYEELNFNGVVIKDVTFDKLMTYFDYFDSDVSN 473 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.8 bits (49), Expect = 5.8 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 10/52 (19%) Frame = +2 Query: 389 IYNKFKSVVSYAQSDLPLYTK----------KSIESASKLTAYDSLDSDVSN 514 +Y +F + Y + LP YT K + +T +D DSDVSN Sbjct: 422 LYERFMDLYYYFKRFLPSYTYEELNFNGVVIKDVTFDKLMTYFDYFDSDVSN 473 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.8 bits (49), Expect = 5.8 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 10/52 (19%) Frame = +2 Query: 389 IYNKFKSVVSYAQSDLPLYTK----------KSIESASKLTAYDSLDSDVSN 514 +Y +F + Y + LP YT K + +T +D DSDVSN Sbjct: 422 LYERFMDLYYYFKRFLPSYTYEELNFNGVVIKDVTFDKLMTYFDYFDSDVSN 473 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 23.4 bits (48), Expect = 7.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 657 QQDPSSCHHQGAHRDH 704 QQ PSS H Q H+ H Sbjct: 220 QQHPSSQHQQPTHQTH 235 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 715,990 Number of Sequences: 2352 Number of extensions: 13928 Number of successful extensions: 97 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 95 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 97 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -