BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0713 (427 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF039041-1|AAP46271.1| 1067|Caenorhabditis elegans Laminin relat... 32 0.20 U61947-7|AAB03137.1| 735|Caenorhabditis elegans Hypothetical pr... 27 5.6 Z68298-1|CAA92598.2| 342|Caenorhabditis elegans Hypothetical pr... 26 9.8 AL117206-13|CAB60454.2| 1651|Caenorhabditis elegans Hypothetical... 26 9.8 AL110498-8|CAB57911.2| 1651|Caenorhabditis elegans Hypothetical ... 26 9.8 AF040641-1|AAB94947.2| 203|Caenorhabditis elegans Calponin prot... 26 9.8 >AF039041-1|AAP46271.1| 1067|Caenorhabditis elegans Laminin related. see also lmb-protein 1 protein. Length = 1067 Score = 31.9 bits (69), Expect = 0.20 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +3 Query: 105 SCISGKRGRRC--CNIWHWGSVDSISGSRARFQLSGN 209 +C SG +G RC C HWGS + G+ R +GN Sbjct: 973 NCKSGYQGERCGECAQNHWGSPREVGGTCERCDCNGN 1009 >U61947-7|AAB03137.1| 735|Caenorhabditis elegans Hypothetical protein C06G3.9 protein. Length = 735 Score = 27.1 bits (57), Expect = 5.6 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +3 Query: 153 WGSVDSISGSRARFQLSGNSGRKHSRCCTSILRKLVA 263 W + ++ R QLS +S + C +L+KL+A Sbjct: 4 WADIQKLASDLQRVQLSQSSKKLSEVNCIEVLQKLIA 40 >Z68298-1|CAA92598.2| 342|Caenorhabditis elegans Hypothetical protein F44D12.2 protein. Length = 342 Score = 26.2 bits (55), Expect = 9.8 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -1 Query: 154 QCHILQHRRPRLPLMQLEAPCSFNFCSLRAIRR 56 +CH+ + PRLP ++ + C FC + A R Sbjct: 214 ECHV-DYFNPRLPYVKSGSSCIGQFCFISATSR 245 >AL117206-13|CAB60454.2| 1651|Caenorhabditis elegans Hypothetical protein Y64G10A.7 protein. Length = 1651 Score = 26.2 bits (55), Expect = 9.8 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 3/52 (5%) Frame = +3 Query: 90 EHGASSCISGKRGRRC---CNIWHWGSVDSISGSRARFQLSGNSGRKHSRCC 236 EH SC+SG G +C C + D ISG Q G G+K +R C Sbjct: 1195 EHCEKSCVSGHYGAKCEETCECENGALCDPISG-HCSCQ-PGWRGKKCNRPC 1244 >AL110498-8|CAB57911.2| 1651|Caenorhabditis elegans Hypothetical protein Y64G10A.7 protein. Length = 1651 Score = 26.2 bits (55), Expect = 9.8 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 3/52 (5%) Frame = +3 Query: 90 EHGASSCISGKRGRRC---CNIWHWGSVDSISGSRARFQLSGNSGRKHSRCC 236 EH SC+SG G +C C + D ISG Q G G+K +R C Sbjct: 1195 EHCEKSCVSGHYGAKCEETCECENGALCDPISG-HCSCQ-PGWRGKKCNRPC 1244 >AF040641-1|AAB94947.2| 203|Caenorhabditis elegans Calponin protein 2 protein. Length = 203 Score = 26.2 bits (55), Expect = 9.8 Identities = 8/30 (26%), Positives = 18/30 (60%) Frame = -1 Query: 175 LMESTDPQCHILQHRRPRLPLMQLEAPCSF 86 L+E DP C ++ +++P++ +E +F Sbjct: 68 LIEKLDPSCRVVYNKKPKMAFPMMENISNF 97 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,181,296 Number of Sequences: 27780 Number of extensions: 173420 Number of successful extensions: 377 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 349 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 377 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 703342068 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -