BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0712 (814 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC16E8.11c |tfb1||transcription factor TFIIH complex subunit T... 29 1.0 SPAC23D3.13c |||guanyl-nucleotide exchange factor|Schizosaccharo... 28 1.8 SPBC13G1.14c |||RNA-binding protein|Schizosaccharomyces pombe|ch... 27 4.2 SPCC663.10 |||methyltransferase, DUF1613 family |Schizosaccharom... 25 9.7 >SPAC16E8.11c |tfb1||transcription factor TFIIH complex subunit Tfb1|Schizosaccharomyces pombe|chr 1|||Manual Length = 477 Score = 28.7 bits (61), Expect = 1.0 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +2 Query: 443 RVFLLICSDGELPFKAAVYLTAPPQARTHCDQ-QRKLQGTVQ 565 RVF+++ +GE P + T P AR +CD +L+ +Q Sbjct: 3 RVFIVV-KEGEDPTSLVFHFTGTPNARENCDMITNELRNAIQ 43 >SPAC23D3.13c |||guanyl-nucleotide exchange factor|Schizosaccharomyces pombe|chr 1|||Manual Length = 1616 Score = 27.9 bits (59), Expect = 1.8 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = -1 Query: 382 WHVLLVRCSHPCRNSPQRIRDG*QQSEHKIFHRAHCDGKIQRYATVCRIV 233 W +LLV + C NS +R+G Q +IF+ +A+ C++V Sbjct: 1024 WIMLLVHLADLCENSWASVRNGAAQILFRIFNSQCSKLGTNAWASCCQLV 1073 >SPBC13G1.14c |||RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 243 Score = 26.6 bits (56), Expect = 4.2 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -2 Query: 678 AHFGRRQGHPSQYCRSRGHQPGPNRRRICYQSRRDH 571 +H+ + H S+Y R+R PG N QS H Sbjct: 202 SHYNDKSFHRSRYSRARSRSPGSNISEYSDQSPPYH 237 >SPCC663.10 |||methyltransferase, DUF1613 family |Schizosaccharomyces pombe|chr 3|||Manual Length = 502 Score = 25.4 bits (53), Expect = 9.7 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = -3 Query: 806 YFILKENISERFVGSFSERTDAGEYYGVDV 717 Y ILK+ +++ V ++ E+TD G++ D+ Sbjct: 228 YVILKDKYAKQLVDNWVEKTDPGKHVFEDL 257 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,505,498 Number of Sequences: 5004 Number of extensions: 79183 Number of successful extensions: 237 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 229 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 237 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 396433620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -