BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0700 (728 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_1109 - 11726818-11727719,11728225-11728394,11730407-117304... 28 6.6 >12_01_1109 - 11726818-11727719,11728225-11728394,11730407-11730483, 11730559-11730645,11730730-11730816,11731887-11731991, 11732133-11732168,11733636-11733754,11733862-11734067, 11735854-11735906,11735986-11736153,11736507-11736591, 11737845-11738023,11738939-11739070,11739209-11739295, 11739920-11739972,11740820-11740892,11741791-11742442, 11743165-11743229 Length = 1111 Score = 28.3 bits (60), Expect = 6.6 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = -1 Query: 410 DRAHGPPGVK*DMSSKDLVFTIQQLPHLSNQNATSRQK*AVHTRADSQDVLPPV 249 D+A G VK + V +Q+LPHLS+ +RQ+ V + D + V Sbjct: 693 DKADGDEEVKAAGDNIVGVILLQELPHLSHLGVRARQENVVFVTCEYDDTVTDV 746 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,903,922 Number of Sequences: 37544 Number of extensions: 416708 Number of successful extensions: 798 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 798 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1909952136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -