BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0698 (498 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transpo... 51 3e-08 AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transpo... 51 3e-08 AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transpo... 46 5e-07 DQ518576-1|ABF66618.1| 276|Anopheles gambiae putative cytoplasm... 27 0.35 AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding pr... 24 3.3 AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding pr... 24 3.3 AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding pr... 24 3.3 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 23 4.4 EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 23 4.4 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 4.4 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 23 5.8 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 23 5.8 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 23 5.8 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 23 5.8 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 23 5.8 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 23 5.8 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 23 5.8 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 23 5.8 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 23 5.8 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 23 5.8 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 23 5.8 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 23 5.8 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 23 5.8 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 23 5.8 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 23 5.8 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 23 5.8 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 23 5.8 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 23 5.8 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 23 5.8 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 23 5.8 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 23 5.8 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 23 5.8 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 23 5.8 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 23 5.8 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 23 5.8 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 23 5.8 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 23 5.8 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 23 5.8 DQ080909-1|AAY89555.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080908-1|AAY89554.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080907-1|AAY89553.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080906-1|AAY89552.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080905-1|AAY89551.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080904-1|AAY89550.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080903-1|AAY89549.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080902-1|AAY89548.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080901-1|AAY89547.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080900-1|AAY89546.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080899-1|AAY89545.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080898-1|AAY89544.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080897-1|AAY89543.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080896-1|AAY89542.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080895-1|AAY89541.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080894-1|AAY89540.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080893-1|AAY89539.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080892-1|AAY89538.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080891-1|AAY89537.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080890-1|AAY89536.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080889-1|AAY89535.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080888-1|AAY89534.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080887-1|AAY89533.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080886-1|AAY89532.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080885-1|AAY89531.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080884-1|AAY89530.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080883-1|AAY89529.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080882-1|AAY89528.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080881-1|AAY89527.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080880-1|AAY89526.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080879-1|AAY89525.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080878-1|AAY89524.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080877-1|AAY89523.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080876-1|AAY89522.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080875-1|AAY89521.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080874-1|AAY89520.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080873-1|AAY89519.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080872-1|AAY89518.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080871-1|AAY89517.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080870-1|AAY89516.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080869-1|AAY89515.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080868-1|AAY89514.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080867-1|AAY89513.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080866-1|AAY89512.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080865-1|AAY89511.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080864-1|AAY89510.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080863-1|AAY89509.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 DQ080862-1|AAY89508.1| 120|Anopheles gambiae olfactory receptor... 23 7.6 >AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 50.8 bits (116), Expect = 3e-08 Identities = 18/37 (48%), Positives = 24/37 (64%) Frame = +1 Query: 1 IKTSPYWRMCWGLITPAMMIIVFLYALISYEALLFGG 111 IKT YWR+CWG ITP ++ + LY + +YE F G Sbjct: 524 IKTGLYWRICWGFITPTLLAAILLYHIATYETFTFNG 560 >AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 50.8 bits (116), Expect = 3e-08 Identities = 18/37 (48%), Positives = 24/37 (64%) Frame = +1 Query: 1 IKTSPYWRMCWGLITPAMMIIVFLYALISYEALLFGG 111 IKT YWR+CWG ITP ++ + LY + +YE F G Sbjct: 524 IKTGLYWRICWGFITPTLLAAILLYHIATYETFTFNG 560 >AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transporter Ag_AAT8 protein. Length = 636 Score = 46.4 bits (105), Expect = 5e-07 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 4/84 (4%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFLYALISYEALLFG----GMAGYVAXXXXXXXXXXXXPISICL 183 YWR+CW ITP +M ++ +Y L++ E L++ Y PI Sbjct: 535 YWRLCWRWITPLLMFVILIYNLVTLEPLMYRQYVYPTVAYGIGWCIFAFGLLQLPIWAAY 594 Query: 184 TLYKYRTGNFIETLKLSFRSKESW 255 +YK+ + E +K +F+ +W Sbjct: 595 AVYKHSGKSLNEKIKNAFKPTAAW 618 >DQ518576-1|ABF66618.1| 276|Anopheles gambiae putative cytoplasmic carbonic anhydrase protein. Length = 276 Score = 27.1 bits (57), Expect = 0.35 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 219 DSKAFFPLQGILGPRSAGERRTWLSFKEDAKVLREKL 329 + KA++ G L E TW+ FKE +V E+L Sbjct: 189 EGKAYWTYLGSLTTPPCSESVTWILFKEPIEVSHEQL 225 >AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding protein AgamOBP30 protein. Length = 289 Score = 23.8 bits (49), Expect = 3.3 Identities = 14/62 (22%), Positives = 23/62 (37%) Frame = -1 Query: 279 CVRQLILDPRFLGAERKL*SLNEVSSPVLVQCKADGNRYQQNTHDQQQVTSHISGHSSEE 100 CVR L + L K N+ + +V+C + +TH Q+ + H Sbjct: 58 CVRYLRIPCARLAVYNKFIYPNDAETQCMVRCMGLNLGWWNDTHGVQEASMRSFFHPDPN 117 Query: 99 QC 94 C Sbjct: 118 DC 119 >AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding protein OBPjj83c protein. Length = 273 Score = 23.8 bits (49), Expect = 3.3 Identities = 14/62 (22%), Positives = 23/62 (37%) Frame = -1 Query: 279 CVRQLILDPRFLGAERKL*SLNEVSSPVLVQCKADGNRYQQNTHDQQQVTSHISGHSSEE 100 CVR L + L K N+ + +V+C + +TH Q+ + H Sbjct: 42 CVRYLRIPCARLAVYNKFIYPNDAETQCMVRCMGLNLGWWNDTHGVQEASMRSFFHPDPN 101 Query: 99 QC 94 C Sbjct: 102 DC 103 >AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding protein 1 protein. Length = 289 Score = 23.8 bits (49), Expect = 3.3 Identities = 14/62 (22%), Positives = 23/62 (37%) Frame = -1 Query: 279 CVRQLILDPRFLGAERKL*SLNEVSSPVLVQCKADGNRYQQNTHDQQQVTSHISGHSSEE 100 CVR L + L K N+ + +V+C + +TH Q+ + H Sbjct: 58 CVRYLRIPCARLAVYNKFIYPNDAETQCMVRCMGLNLGWWNDTHGVQEASMRSFFHPDPN 117 Query: 99 QC 94 C Sbjct: 118 DC 119 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.4 bits (48), Expect = 4.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFL 72 +WRMCW L + ++++ L Sbjct: 758 FWRMCWELKSSTIVMMTRL 776 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 23.4 bits (48), Expect = 4.4 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 34 GLITPAMMIIVFLYALISYEALLFGGM 114 GL T A+ +F+Y A+ FGG+ Sbjct: 442 GLNTEALAATIFMYFAALSTAITFGGL 468 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.4 bits (48), Expect = 4.4 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -1 Query: 207 SSPVLVQCKADGNRYQQNTHDQ 142 + PV V+C+ GN +Q+ D+ Sbjct: 1179 TEPVCVKCRKSGNSHQEVPADE 1200 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 74 LSITTKYYETNIVPKSRHTPQII 96 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 74 LSITTKYYETNIVPKSRHTPQII 96 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 74 LSITTKYYETNIVPKSRHTPQII 96 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 74 LSITTKYYETNIVPKSRHTPQII 96 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 74 LSITTKYYETNIVPKSRHTPQII 96 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 74 LSITTKYYETNIVPKSRHTPQII 96 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 59 LSITTKYYETNIVPKSRHTPQII 81 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 59 LSITTKYYETNIVPKSRHTPQII 81 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 61 LSITTKYYETNIVPKSRHTPQII 83 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 61 LSITTKYYETNIVPKSRHTPQII 83 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 64 LSITTKYYETNIVPKSRHTPQII 86 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 64 LSITTKYYETNIVPKSRHTPQII 86 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 74 LSITTKYYETNIVPKSRHTPQII 96 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 74 LSITTKYYETNIVPKSRHTPQII 96 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 74 LSITTKYYETNIVPKSRHTPQII 96 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 74 LSITTKYYETNIVPKSRHTPQII 96 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 74 LSITTKYYETNIVPKSRHTPQII 96 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 74 LSITTKYYETNIVPKSRHTPQII 96 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 76 LSITTKYYETNIVPKSRHTPQII 98 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 76 LSITTKYYETNIVPKSRHTPQII 98 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 58 LSITTKYYETNIVPKSRHTPQII 80 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 58 LSITTKYYETNIVPKSRHTPQII 80 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 295 LKKTRKYYEKNLIPHESRMSGIV 363 L T KYYE N++P I+ Sbjct: 73 LSITTKYYETNIVPKSRHTPQII 95 >DQ080909-1|AAY89555.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080908-1|AAY89554.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080907-1|AAY89553.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080906-1|AAY89552.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080905-1|AAY89551.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080904-1|AAY89550.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080903-1|AAY89549.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080902-1|AAY89548.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080901-1|AAY89547.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080900-1|AAY89546.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080899-1|AAY89545.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080898-1|AAY89544.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080897-1|AAY89543.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080896-1|AAY89542.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080895-1|AAY89541.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080894-1|AAY89540.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080893-1|AAY89539.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080892-1|AAY89538.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080891-1|AAY89537.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080890-1|AAY89536.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080889-1|AAY89535.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080888-1|AAY89534.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080887-1|AAY89533.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080886-1|AAY89532.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080885-1|AAY89531.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080884-1|AAY89530.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080883-1|AAY89529.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080882-1|AAY89528.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080881-1|AAY89527.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080880-1|AAY89526.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080879-1|AAY89525.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080878-1|AAY89524.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080877-1|AAY89523.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080876-1|AAY89522.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080875-1|AAY89521.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080874-1|AAY89520.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080873-1|AAY89519.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080872-1|AAY89518.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080871-1|AAY89517.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080870-1|AAY89516.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080869-1|AAY89515.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080868-1|AAY89514.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080867-1|AAY89513.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080866-1|AAY89512.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080865-1|AAY89511.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080864-1|AAY89510.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080863-1|AAY89509.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 >DQ080862-1|AAY89508.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 187 LYKYRTGNFIETLK 228 LY YR G+ IET++ Sbjct: 69 LYAYRNGSLIETIE 82 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 528,784 Number of Sequences: 2352 Number of extensions: 11168 Number of successful extensions: 131 Number of sequences better than 10.0: 110 Number of HSP's better than 10.0 without gapping: 131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 131 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44400195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -