BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0698 (498 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF352733-1|AAK29670.1| 797|Homo sapiens glycine type 2 transpor... 39 0.008 Z96810-2|CAI42799.1| 642|Homo sapiens solute carrier family 6 (... 38 0.019 BC096321-1|AAH96321.1| 797|Homo sapiens solute carrier family 6... 38 0.019 BC096320-1|AAH96320.1| 797|Homo sapiens solute carrier family 6... 38 0.019 BC096319-1|AAH96319.1| 797|Homo sapiens solute carrier family 6... 38 0.019 BC093712-1|AAH93712.1| 642|Homo sapiens solute carrier family 6... 38 0.019 BC093710-1|AAH93710.1| 642|Homo sapiens solute carrier family 6... 38 0.019 AL034411-1|CAI43081.1| 642|Homo sapiens solute carrier family 6... 38 0.019 AF151978-1|AAD49223.1| 642|Homo sapiens amino acid transporter ... 38 0.019 AF142501-1|AAD27892.1| 797|Homo sapiens glycine transporter typ... 38 0.019 AF117999-1|AAK12641.1| 797|Homo sapiens sodium- and chloride-de... 38 0.019 AF085412-1|AAC95145.1| 797|Homo sapiens glycine transporter GLY... 38 0.019 X91117-2|CAC39181.1| 628|Homo sapiens SLC6A2 protein. 37 0.034 X91117-1|CAA62566.1| 617|Homo sapiens norepinephrine transporte... 37 0.034 M65105-1|AAA59943.1| 617|Homo sapiens noradrenaline transporter... 37 0.034 BC000563-1|AAH00563.2| 325|Homo sapiens SLC6A2 protein protein. 37 0.034 S46955-1|AAA11754.1| 620|Homo sapiens dopamine transporter prot... 36 0.078 S44626-1|AAB23443.1| 620|Homo sapiens dopamine transporter prot... 36 0.078 M95167-1|AAC41720.1| 620|Homo sapiens dopamine transporter prot... 36 0.078 L24178-1|AAA19560.1| 620|Homo sapiens dopamine transporter prot... 36 0.078 D88570-1|BAA22511.1| 620|Homo sapiens dopamine transporter prot... 36 0.078 BC133003-1|AAI33004.1| 620|Homo sapiens solute carrier family 6... 36 0.078 BC132977-1|AAI32978.1| 620|Homo sapiens solute carrier family 6... 36 0.078 AY623110-1|AAT38106.1| 620|Homo sapiens solute carrier family 6... 36 0.078 AF321321-1|AAG33844.1| 620|Homo sapiens dopamine transporter pr... 36 0.078 AF119117-1|AAC50179.2| 620|Homo sapiens dopamine transporter pr... 36 0.078 S80071-1|AAB47007.2| 636|Homo sapiens brain-specific L-proline ... 33 0.55 BC113425-1|AAI13426.1| 636|Homo sapiens solute carrier family 6... 33 0.55 BC093785-1|AAH93785.1| 636|Homo sapiens solute carrier family 6... 33 0.55 BC069631-1|AAH69631.1| 636|Homo sapiens solute carrier family 6... 33 0.55 Z66539-1|CAA91442.1| 635|Homo sapiens creatine transporter prot... 33 0.73 U36341-1|AAA79507.1| 635|Homo sapiens creatine transporter prot... 33 0.73 U17986-1|AAA86990.1| 732|Homo sapiens GABA/noradrenaline transp... 33 0.73 S75989-1|AAB33570.1| 632|Homo sapiens gamma-aminobutyric acid t... 33 0.73 S74039-1|AAB32284.1| 635|Homo sapiens creatine transporter prot... 33 0.73 L31409-1|AAC41688.1| 635|Homo sapiens creatine transporter prot... 33 0.73 BC081558-1|AAH81558.1| 635|Homo sapiens solute carrier family 6... 33 0.73 BC056757-1|AAH56757.1| 628|Homo sapiens solute carrier family 6... 33 0.73 BC012355-1|AAH12355.1| 635|Homo sapiens SLC6A8 protein protein. 33 0.73 AK055798-1|BAB71018.1| 628|Homo sapiens protein ( Homo sapiens ... 33 0.73 AB209704-1|BAD92941.1| 644|Homo sapiens solute carrier family 6... 33 0.73 X54673-1|CAA38484.1| 599|Homo sapiens GABA transporter protein. 32 1.3 U76343-1|AAF64247.1| 569|Homo sapiens GABA transport protein pr... 32 1.3 BC033904-1|AAH33904.1| 599|Homo sapiens solute carrier family 6... 32 1.3 BC022392-1|AAH22392.1| 602|Homo sapiens solute carrier family 6... 32 1.3 U41163-1|AAA96028.1| 426|Homo sapiens creatine transporter prot... 31 2.2 AY596807-1|AAT42127.1| 634|Homo sapiens sodium-dependent amino ... 31 2.2 AY591756-1|AAT66171.1| 634|Homo sapiens system B0 neutral amino... 31 2.2 AK125843-1|BAC86314.1| 288|Homo sapiens protein ( Homo sapiens ... 31 2.9 U16120-1|AAA50842.1| 620|Homo sapiens placental taurine transpo... 30 3.9 U09220-1|AAC50443.1| 620|Homo sapiens taurine transporter protein. 30 3.9 S70612-1|AAB30785.1| 638|Homo sapiens glycine transporter type ... 30 3.9 S70609-1|AAB30784.1| 692|Homo sapiens glycine transporter type ... 30 3.9 AL139220-4|CAI19430.1| 633|Homo sapiens solute carrier family 6... 30 3.9 AL139220-3|CAI19429.1| 692|Homo sapiens solute carrier family 6... 30 3.9 AL139220-2|CAI19428.1| 638|Homo sapiens solute carrier family 6... 30 3.9 BC064348-1|AAH64348.1| 944|Homo sapiens chromosome 13 open read... 29 9.0 BC053566-1|AAH53566.1| 781|Homo sapiens C13orf23 protein protein. 29 9.0 AL445590-3|CAI40975.1| 944|Homo sapiens chromosome 13 open read... 29 9.0 AK097051-1|BAC04935.1| 185|Homo sapiens protein ( Homo sapiens ... 29 9.0 AB107354-1|BAC67659.1| 952|Homo sapiens KIAA2032 protein protein. 29 9.0 >AF352733-1|AAK29670.1| 797|Homo sapiens glycine type 2 transporter variant SC6 protein. Length = 797 Score = 39.1 bits (87), Expect = 0.008 Identities = 18/84 (21%), Positives = 35/84 (41%), Gaps = 4/84 (4%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFLYALISYEALLFGGMA----GYVAXXXXXXXXXXXXPISICL 183 +W++CW +TP ++ + ++ +E + +G V PI + Sbjct: 676 FWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVI 735 Query: 184 TLYKYRTGNFIETLKLSFRSKESW 255 ++ G FIE LKL+ + W Sbjct: 736 KMH-LAPGRFIERLKLACSPQPDW 758 >Z96810-2|CAI42799.1| 642|Homo sapiens solute carrier family 6 (amino acid transporter),in 1 protein. Length = 642 Score = 37.9 bits (84), Expect = 0.019 Identities = 11/33 (33%), Positives = 23/33 (69%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFLYALISYEALLFGGM 114 +WR CW +ITP ++I +F+++L+ + +G + Sbjct: 524 WWRACWFVITPILLIAIFIWSLVQFHRPNYGAI 556 >BC096321-1|AAH96321.1| 797|Homo sapiens solute carrier family 6 (neurotransmitter transporter, glycine), member 5 protein. Length = 797 Score = 37.9 bits (84), Expect = 0.019 Identities = 18/84 (21%), Positives = 34/84 (40%), Gaps = 4/84 (4%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFLYALISYEALLFGGMA----GYVAXXXXXXXXXXXXPISICL 183 +W++CW +TP ++ + ++ +E + +G V PI + Sbjct: 676 FWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVI 735 Query: 184 TLYKYRTGNFIETLKLSFRSKESW 255 ++ G FIE LKL + W Sbjct: 736 KMH-LAPGRFIERLKLVCSPQPDW 758 >BC096320-1|AAH96320.1| 797|Homo sapiens solute carrier family 6 (neurotransmitter transporter, glycine), member 5 protein. Length = 797 Score = 37.9 bits (84), Expect = 0.019 Identities = 18/84 (21%), Positives = 34/84 (40%), Gaps = 4/84 (4%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFLYALISYEALLFGGMA----GYVAXXXXXXXXXXXXPISICL 183 +W++CW +TP ++ + ++ +E + +G V PI + Sbjct: 676 FWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVI 735 Query: 184 TLYKYRTGNFIETLKLSFRSKESW 255 ++ G FIE LKL + W Sbjct: 736 KMH-LAPGRFIERLKLVCSPQPDW 758 >BC096319-1|AAH96319.1| 797|Homo sapiens solute carrier family 6 (neurotransmitter transporter, glycine), member 5 protein. Length = 797 Score = 37.9 bits (84), Expect = 0.019 Identities = 18/84 (21%), Positives = 34/84 (40%), Gaps = 4/84 (4%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFLYALISYEALLFGGMA----GYVAXXXXXXXXXXXXPISICL 183 +W++CW +TP ++ + ++ +E + +G V PI + Sbjct: 676 FWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVI 735 Query: 184 TLYKYRTGNFIETLKLSFRSKESW 255 ++ G FIE LKL + W Sbjct: 736 KMH-LAPGRFIERLKLVCSPQPDW 758 >BC093712-1|AAH93712.1| 642|Homo sapiens solute carrier family 6 (amino acid transporter), member 14 protein. Length = 642 Score = 37.9 bits (84), Expect = 0.019 Identities = 11/33 (33%), Positives = 23/33 (69%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFLYALISYEALLFGGM 114 +WR CW +ITP ++I +F+++L+ + +G + Sbjct: 524 WWRACWFVITPILLIAIFIWSLVQFHRPNYGAI 556 >BC093710-1|AAH93710.1| 642|Homo sapiens solute carrier family 6 (amino acid transporter), member 14 protein. Length = 642 Score = 37.9 bits (84), Expect = 0.019 Identities = 11/33 (33%), Positives = 23/33 (69%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFLYALISYEALLFGGM 114 +WR CW +ITP ++I +F+++L+ + +G + Sbjct: 524 WWRACWFVITPILLIAIFIWSLVQFHRPNYGAI 556 >AL034411-1|CAI43081.1| 642|Homo sapiens solute carrier family 6 (amino acid transporter),ene protein. Length = 642 Score = 37.9 bits (84), Expect = 0.019 Identities = 11/33 (33%), Positives = 23/33 (69%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFLYALISYEALLFGGM 114 +WR CW +ITP ++I +F+++L+ + +G + Sbjct: 524 WWRACWFVITPILLIAIFIWSLVQFHRPNYGAI 556 >AF151978-1|AAD49223.1| 642|Homo sapiens amino acid transporter B0+ protein. Length = 642 Score = 37.9 bits (84), Expect = 0.019 Identities = 11/33 (33%), Positives = 23/33 (69%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFLYALISYEALLFGGM 114 +WR CW +ITP ++I +F+++L+ + +G + Sbjct: 524 WWRACWFVITPILLIAIFIWSLVQFHRPNYGAI 556 >AF142501-1|AAD27892.1| 797|Homo sapiens glycine transporter type-2 protein. Length = 797 Score = 37.9 bits (84), Expect = 0.019 Identities = 18/84 (21%), Positives = 34/84 (40%), Gaps = 4/84 (4%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFLYALISYEALLFGGMA----GYVAXXXXXXXXXXXXPISICL 183 +W++CW +TP ++ + ++ +E + +G V PI + Sbjct: 676 FWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVI 735 Query: 184 TLYKYRTGNFIETLKLSFRSKESW 255 ++ G FIE LKL + W Sbjct: 736 KMH-LAPGRFIERLKLVCSPQPDW 758 >AF117999-1|AAK12641.1| 797|Homo sapiens sodium- and chloride-dependent glycine transporter type II protein. Length = 797 Score = 37.9 bits (84), Expect = 0.019 Identities = 18/84 (21%), Positives = 34/84 (40%), Gaps = 4/84 (4%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFLYALISYEALLFGGMA----GYVAXXXXXXXXXXXXPISICL 183 +W++CW +TP ++ + ++ +E + +G V PI + Sbjct: 676 FWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVI 735 Query: 184 TLYKYRTGNFIETLKLSFRSKESW 255 ++ G FIE LKL + W Sbjct: 736 KMH-LAPGRFIERLKLVCSPQPDW 758 >AF085412-1|AAC95145.1| 797|Homo sapiens glycine transporter GLYT2 protein. Length = 797 Score = 37.9 bits (84), Expect = 0.019 Identities = 18/84 (21%), Positives = 34/84 (40%), Gaps = 4/84 (4%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFLYALISYEALLFGGMA----GYVAXXXXXXXXXXXXPISICL 183 +W++CW +TP ++ + ++ +E + +G V PI + Sbjct: 676 FWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVI 735 Query: 184 TLYKYRTGNFIETLKLSFRSKESW 255 ++ G FIE LKL + W Sbjct: 736 KMH-LAPGRFIERLKLVCSPQPDW 758 >X91117-2|CAC39181.1| 628|Homo sapiens SLC6A2 protein. Length = 628 Score = 37.1 bits (82), Expect = 0.034 Identities = 10/30 (33%), Positives = 22/30 (73%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFLYALISYEALLF 105 YWR+CW ++PA ++ V + ++I+++ L + Sbjct: 516 YWRLCWKFVSPAFLLFVVVVSIINFKPLTY 545 >X91117-1|CAA62566.1| 617|Homo sapiens norepinephrine transporter protein. Length = 617 Score = 37.1 bits (82), Expect = 0.034 Identities = 10/30 (33%), Positives = 22/30 (73%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFLYALISYEALLF 105 YWR+CW ++PA ++ V + ++I+++ L + Sbjct: 516 YWRLCWKFVSPAFLLFVVVVSIINFKPLTY 545 >M65105-1|AAA59943.1| 617|Homo sapiens noradrenaline transporter protein. Length = 617 Score = 37.1 bits (82), Expect = 0.034 Identities = 10/30 (33%), Positives = 22/30 (73%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFLYALISYEALLF 105 YWR+CW ++PA ++ V + ++I+++ L + Sbjct: 516 YWRLCWKFVSPAFLLFVVVVSIINFKPLTY 545 >BC000563-1|AAH00563.2| 325|Homo sapiens SLC6A2 protein protein. Length = 325 Score = 37.1 bits (82), Expect = 0.034 Identities = 10/30 (33%), Positives = 22/30 (73%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFLYALISYEALLF 105 YWR+CW ++PA ++ V + ++I+++ L + Sbjct: 224 YWRLCWKFVSPAFLLFVVVVSIINFKPLTY 253 >S46955-1|AAA11754.1| 620|Homo sapiens dopamine transporter protein. Length = 620 Score = 35.9 bits (79), Expect = 0.078 Identities = 10/35 (28%), Positives = 23/35 (65%) Frame = +1 Query: 4 KTSPYWRMCWGLITPAMMIIVFLYALISYEALLFG 108 + S YWR+CW L++P ++ V + +++++ +G Sbjct: 515 RPSLYWRLCWKLVSPCFLLFVVVVSIVTFRPPHYG 549 >S44626-1|AAB23443.1| 620|Homo sapiens dopamine transporter protein. Length = 620 Score = 35.9 bits (79), Expect = 0.078 Identities = 10/35 (28%), Positives = 23/35 (65%) Frame = +1 Query: 4 KTSPYWRMCWGLITPAMMIIVFLYALISYEALLFG 108 + S YWR+CW L++P ++ V + +++++ +G Sbjct: 515 RPSLYWRLCWKLVSPCFLLFVVVVSIVTFRPPHYG 549 >M95167-1|AAC41720.1| 620|Homo sapiens dopamine transporter protein. Length = 620 Score = 35.9 bits (79), Expect = 0.078 Identities = 10/35 (28%), Positives = 23/35 (65%) Frame = +1 Query: 4 KTSPYWRMCWGLITPAMMIIVFLYALISYEALLFG 108 + S YWR+CW L++P ++ V + +++++ +G Sbjct: 515 RPSLYWRLCWKLVSPCFLLFVVVVSIVTFRPPHYG 549 >L24178-1|AAA19560.1| 620|Homo sapiens dopamine transporter protein. Length = 620 Score = 35.9 bits (79), Expect = 0.078 Identities = 10/35 (28%), Positives = 23/35 (65%) Frame = +1 Query: 4 KTSPYWRMCWGLITPAMMIIVFLYALISYEALLFG 108 + S YWR+CW L++P ++ V + +++++ +G Sbjct: 515 RPSLYWRLCWKLVSPCFLLFVVVVSIVTFRPPHYG 549 >D88570-1|BAA22511.1| 620|Homo sapiens dopamine transporter protein. Length = 620 Score = 35.9 bits (79), Expect = 0.078 Identities = 10/35 (28%), Positives = 23/35 (65%) Frame = +1 Query: 4 KTSPYWRMCWGLITPAMMIIVFLYALISYEALLFG 108 + S YWR+CW L++P ++ V + +++++ +G Sbjct: 515 RPSLYWRLCWKLVSPCFLLFVVVVSIVTFRPPHYG 549 >BC133003-1|AAI33004.1| 620|Homo sapiens solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 protein. Length = 620 Score = 35.9 bits (79), Expect = 0.078 Identities = 10/35 (28%), Positives = 23/35 (65%) Frame = +1 Query: 4 KTSPYWRMCWGLITPAMMIIVFLYALISYEALLFG 108 + S YWR+CW L++P ++ V + +++++ +G Sbjct: 515 RPSLYWRLCWKLVSPCFLLFVVVVSIVTFRPPHYG 549 >BC132977-1|AAI32978.1| 620|Homo sapiens solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 protein. Length = 620 Score = 35.9 bits (79), Expect = 0.078 Identities = 10/35 (28%), Positives = 23/35 (65%) Frame = +1 Query: 4 KTSPYWRMCWGLITPAMMIIVFLYALISYEALLFG 108 + S YWR+CW L++P ++ V + +++++ +G Sbjct: 515 RPSLYWRLCWKLVSPCFLLFVVVVSIVTFRPPHYG 549 >AY623110-1|AAT38106.1| 620|Homo sapiens solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 protein. Length = 620 Score = 35.9 bits (79), Expect = 0.078 Identities = 10/35 (28%), Positives = 23/35 (65%) Frame = +1 Query: 4 KTSPYWRMCWGLITPAMMIIVFLYALISYEALLFG 108 + S YWR+CW L++P ++ V + +++++ +G Sbjct: 515 RPSLYWRLCWKLVSPCFLLFVVVVSIVTFRPPHYG 549 >AF321321-1|AAG33844.1| 620|Homo sapiens dopamine transporter protein. Length = 620 Score = 35.9 bits (79), Expect = 0.078 Identities = 10/35 (28%), Positives = 23/35 (65%) Frame = +1 Query: 4 KTSPYWRMCWGLITPAMMIIVFLYALISYEALLFG 108 + S YWR+CW L++P ++ V + +++++ +G Sbjct: 515 RPSLYWRLCWKLVSPCFLLFVVVVSIVTFRPPHYG 549 >AF119117-1|AAC50179.2| 620|Homo sapiens dopamine transporter protein. Length = 620 Score = 35.9 bits (79), Expect = 0.078 Identities = 10/35 (28%), Positives = 23/35 (65%) Frame = +1 Query: 4 KTSPYWRMCWGLITPAMMIIVFLYALISYEALLFG 108 + S YWR+CW L++P ++ V + +++++ +G Sbjct: 515 RPSLYWRLCWKLVSPCFLLFVVVVSIVTFRPPHYG 549 >S80071-1|AAB47007.2| 636|Homo sapiens brain-specific L-proline transporter protein. Length = 636 Score = 33.1 bits (72), Expect = 0.55 Identities = 10/35 (28%), Positives = 22/35 (62%) Frame = +1 Query: 4 KTSPYWRMCWGLITPAMMIIVFLYALISYEALLFG 108 K Y+R CW ++PA ++ + +Y+++ Y+ +G Sbjct: 493 KPGLYFRACWLFLSPATLLALLVYSIVKYQPSEYG 527 >BC113425-1|AAI13426.1| 636|Homo sapiens solute carrier family 6 (neurotransmitter transporter, L-proline), member 7 protein. Length = 636 Score = 33.1 bits (72), Expect = 0.55 Identities = 10/35 (28%), Positives = 22/35 (62%) Frame = +1 Query: 4 KTSPYWRMCWGLITPAMMIIVFLYALISYEALLFG 108 K Y+R CW ++PA ++ + +Y+++ Y+ +G Sbjct: 493 KPGLYFRACWLFLSPATLLALLVYSIVKYQPSEYG 527 >BC093785-1|AAH93785.1| 636|Homo sapiens solute carrier family 6 (neurotransmitter transporter, L-proline), member 7 protein. Length = 636 Score = 33.1 bits (72), Expect = 0.55 Identities = 10/35 (28%), Positives = 22/35 (62%) Frame = +1 Query: 4 KTSPYWRMCWGLITPAMMIIVFLYALISYEALLFG 108 K Y+R CW ++PA ++ + +Y+++ Y+ +G Sbjct: 493 KPGLYFRACWLFLSPATLLALLVYSIVKYQPSEYG 527 >BC069631-1|AAH69631.1| 636|Homo sapiens solute carrier family 6 (neurotransmitter transporter, L-proline), member 7 protein. Length = 636 Score = 33.1 bits (72), Expect = 0.55 Identities = 10/35 (28%), Positives = 22/35 (62%) Frame = +1 Query: 4 KTSPYWRMCWGLITPAMMIIVFLYALISYEALLFG 108 K Y+R CW ++PA ++ + +Y+++ Y+ +G Sbjct: 493 KPGLYFRACWLFLSPATLLALLVYSIVKYQPSEYG 527 >Z66539-1|CAA91442.1| 635|Homo sapiens creatine transporter protein. Length = 635 Score = 32.7 bits (71), Expect = 0.73 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = +1 Query: 13 PYWRMCWGLITPAMMIIVFLYALISYEALLFGGMAGY 123 P+ + CW TP + + +F++ ++ YE L++ Y Sbjct: 517 PWMKWCWSFFTPLVCMGIFIFNVVYYEPLVYNNTYVY 553 >U36341-1|AAA79507.1| 635|Homo sapiens creatine transporter protein. Length = 635 Score = 32.7 bits (71), Expect = 0.73 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = +1 Query: 13 PYWRMCWGLITPAMMIIVFLYALISYEALLFGGMAGY 123 P+ + CW TP + + +F++ ++ YE L++ Y Sbjct: 517 PWMKWCWSFFTPLVCMGIFIFNVVYYEPLVYNNTYVY 553 >U17986-1|AAA86990.1| 732|Homo sapiens GABA/noradrenaline transporter protein. Length = 732 Score = 32.7 bits (71), Expect = 0.73 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = +1 Query: 13 PYWRMCWGLITPAMMIIVFLYALISYEALLFGGMAGY 123 P+ + CW TP + + +F++ ++ YE L++ Y Sbjct: 614 PWMKWCWSFFTPLVCMGIFIFNVVYYEPLVYNNTYVY 650 >S75989-1|AAB33570.1| 632|Homo sapiens gamma-aminobutyric acid transporter type 3 protein. Length = 632 Score = 32.7 bits (71), Expect = 0.73 Identities = 16/63 (25%), Positives = 30/63 (47%), Gaps = 5/63 (7%) Frame = +1 Query: 22 RMCWGLITPAMMIIVFLYALISYEALLFGGMA-----GYVAXXXXXXXXXXXXPISICLT 186 + CW ++TP + +F++ LI Y+ L + + GY P+ IC+T Sbjct: 513 KWCWMIMTPGICAGIFIFFLIKYKPLKYNNIYTYPAWGYGIGWLMALSSMLCIPLWICIT 572 Query: 187 LYK 195 ++K Sbjct: 573 VWK 575 >S74039-1|AAB32284.1| 635|Homo sapiens creatine transporter protein. Length = 635 Score = 32.7 bits (71), Expect = 0.73 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = +1 Query: 13 PYWRMCWGLITPAMMIIVFLYALISYEALLFGGMAGY 123 P+ + CW TP + + +F++ ++ YE L++ Y Sbjct: 517 PWMKWCWSFFTPLVCMGIFIFNVVYYEPLVYNNTYVY 553 >L31409-1|AAC41688.1| 635|Homo sapiens creatine transporter protein. Length = 635 Score = 32.7 bits (71), Expect = 0.73 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = +1 Query: 13 PYWRMCWGLITPAMMIIVFLYALISYEALLFGGMAGY 123 P+ + CW TP + + +F++ ++ YE L++ Y Sbjct: 517 PWMKWCWSFFTPLVCMGIFIFNVVYYEPLVYNNTYVY 553 >BC081558-1|AAH81558.1| 635|Homo sapiens solute carrier family 6 (neurotransmitter transporter, creatine), member 8 protein. Length = 635 Score = 32.7 bits (71), Expect = 0.73 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = +1 Query: 13 PYWRMCWGLITPAMMIIVFLYALISYEALLFGGMAGY 123 P+ + CW TP + + +F++ ++ YE L++ Y Sbjct: 517 PWMKWCWSFFTPLVCMGIFIFNVVYYEPLVYNNTYVY 553 >BC056757-1|AAH56757.1| 628|Homo sapiens solute carrier family 6, member 18 protein. Length = 628 Score = 32.7 bits (71), Expect = 0.73 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +1 Query: 4 KTSPYWRMCWGLITPAMMIIVFLYALISY 90 + SPYWR+ W +++P ++ I Y ++ + Sbjct: 511 RPSPYWRLTWRVVSPLLLTIFVAYIILLF 539 >BC012355-1|AAH12355.1| 635|Homo sapiens SLC6A8 protein protein. Length = 635 Score = 32.7 bits (71), Expect = 0.73 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = +1 Query: 13 PYWRMCWGLITPAMMIIVFLYALISYEALLFGGMAGY 123 P+ + CW TP + + +F++ ++ YE L++ Y Sbjct: 517 PWMKWCWSFFTPLVCMGIFIFNVVYYEPLVYNNTYVY 553 >AK055798-1|BAB71018.1| 628|Homo sapiens protein ( Homo sapiens cDNA FLJ31236 fis, clone KIDNE2004828, moderately similar to Mus musculus orphan transporter isoform A12 (Xtrp2) mRNA. ). Length = 628 Score = 32.7 bits (71), Expect = 0.73 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +1 Query: 4 KTSPYWRMCWGLITPAMMIIVFLYALISY 90 + SPYWR+ W +++P ++ I Y ++ + Sbjct: 511 RPSPYWRLTWRVVSPLLLTIFVAYIILLF 539 >AB209704-1|BAD92941.1| 644|Homo sapiens solute carrier family 6 (neurotransmitter transporter, creatine), member 8 vari protein. Length = 644 Score = 32.7 bits (71), Expect = 0.73 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = +1 Query: 13 PYWRMCWGLITPAMMIIVFLYALISYEALLFGGMAGY 123 P+ + CW TP + + +F++ ++ YE L++ Y Sbjct: 526 PWMKWCWSFFTPLVCMGIFIFNVVYYEPLVYNNTYVY 562 >X54673-1|CAA38484.1| 599|Homo sapiens GABA transporter protein. Length = 599 Score = 31.9 bits (69), Expect = 1.3 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFLYALISYEALLFG 108 +W++CW TP ++ VF+++ + L G Sbjct: 495 WWKLCWSFFTPIIVAGVFIFSAVQMTPLTMG 525 >U76343-1|AAF64247.1| 569|Homo sapiens GABA transport protein protein. Length = 569 Score = 31.9 bits (69), Expect = 1.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 13 PYWRMCWGLITPAMMIIVFLYALISYEALLF 105 P + CW +TPA+ FL++LI Y L + Sbjct: 462 PLIKYCWLFLTPAVCTATFLFSLIKYTPLTY 492 >BC033904-1|AAH33904.1| 599|Homo sapiens solute carrier family 6 (neurotransmitter transporter, GABA), member 1 protein. Length = 599 Score = 31.9 bits (69), Expect = 1.3 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFLYALISYEALLFG 108 +W++CW TP ++ VF+++ + L G Sbjct: 495 WWKLCWSFFTPIIVAGVFIFSAVQMTQLTMG 525 >BC022392-1|AAH22392.1| 602|Homo sapiens solute carrier family 6 (neurotransmitter transporter, GABA), member 13 protein. Length = 602 Score = 31.9 bits (69), Expect = 1.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 13 PYWRMCWGLITPAMMIIVFLYALISYEALLF 105 P + CW +TPA+ FL++LI Y L + Sbjct: 490 PLIKYCWLFLTPAVCTATFLFSLIKYTPLTY 520 >U41163-1|AAA96028.1| 426|Homo sapiens creatine transporter protein. Length = 426 Score = 31.1 bits (67), Expect = 2.2 Identities = 9/37 (24%), Positives = 21/37 (56%) Frame = +1 Query: 13 PYWRMCWGLITPAMMIIVFLYALISYEALLFGGMAGY 123 P+ + CW TP + + +F++ ++ Y+ L++ Y Sbjct: 258 PWMKWCWSFFTPLVCMGIFIFNVVYYKPLVYNNTYVY 294 >AY596807-1|AAT42127.1| 634|Homo sapiens sodium-dependent amino acid transporter protein. Length = 634 Score = 31.1 bits (67), Expect = 2.2 Identities = 8/27 (29%), Positives = 20/27 (74%) Frame = +1 Query: 4 KTSPYWRMCWGLITPAMMIIVFLYALI 84 K + +W++ W +++P +M+I+FL+ + Sbjct: 525 KPNIFWQVTWRVVSPLLMLIIFLFFFV 551 >AY591756-1|AAT66171.1| 634|Homo sapiens system B0 neutral amino acid transporter protein. Length = 634 Score = 31.1 bits (67), Expect = 2.2 Identities = 8/27 (29%), Positives = 20/27 (74%) Frame = +1 Query: 4 KTSPYWRMCWGLITPAMMIIVFLYALI 84 K + +W++ W +++P +M+I+FL+ + Sbjct: 525 KPNIFWQVTWRVVSPLLMLIIFLFFFV 551 >AK125843-1|BAC86314.1| 288|Homo sapiens protein ( Homo sapiens cDNA FLJ43855 fis, clone TESTI4007163, highly similar to Sodium- and chloride-dependent creatine transporter 2. ). Length = 288 Score = 30.7 bits (66), Expect = 2.9 Identities = 8/31 (25%), Positives = 20/31 (64%) Frame = +1 Query: 13 PYWRMCWGLITPAMMIIVFLYALISYEALLF 105 P+ + CW TP + + +F++ ++ Y+ L++ Sbjct: 51 PWMKWCWSFFTPLVCMGIFIFNVVYYKPLVY 81 >U16120-1|AAA50842.1| 620|Homo sapiens placental taurine transporter protein. Length = 620 Score = 30.3 bits (65), Expect = 3.9 Identities = 9/34 (26%), Positives = 20/34 (58%) Frame = +1 Query: 4 KTSPYWRMCWGLITPAMMIIVFLYALISYEALLF 105 + P+ + W +ITP + + F+++L+ Y L + Sbjct: 499 RPGPWMKYSWAVITPVLCVGCFIFSLVKYVPLTY 532 >U09220-1|AAC50443.1| 620|Homo sapiens taurine transporter protein. Length = 620 Score = 30.3 bits (65), Expect = 3.9 Identities = 9/34 (26%), Positives = 20/34 (58%) Frame = +1 Query: 4 KTSPYWRMCWGLITPAMMIIVFLYALISYEALLF 105 + P+ + W +ITP + + F+++L+ Y L + Sbjct: 499 RPGPWMKYSWAVITPVLCVGCFIFSLVKYVPLTY 532 >S70612-1|AAB30785.1| 638|Homo sapiens glycine transporter type 1c protein. Length = 638 Score = 30.3 bits (65), Expect = 3.9 Identities = 6/30 (20%), Positives = 21/30 (70%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFLYALISYEALLF 105 ++++CW ++PA++ + ++ +I Y+ + + Sbjct: 503 FFQICWRFVSPAIIFFILVFTVIQYQPITY 532 >S70609-1|AAB30784.1| 692|Homo sapiens glycine transporter type 1b protein. Length = 692 Score = 30.3 bits (65), Expect = 3.9 Identities = 6/30 (20%), Positives = 21/30 (70%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFLYALISYEALLF 105 ++++CW ++PA++ + ++ +I Y+ + + Sbjct: 557 FFQICWRFVSPAIIFFILVFTVIQYQPITY 586 >AL139220-4|CAI19430.1| 633|Homo sapiens solute carrier family 6 (neurotransmitter transporter, glycine), member 9 protein. Length = 633 Score = 30.3 bits (65), Expect = 3.9 Identities = 6/30 (20%), Positives = 21/30 (70%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFLYALISYEALLF 105 ++++CW ++PA++ + ++ +I Y+ + + Sbjct: 498 FFQICWRFVSPAIIFFILVFTVIQYQPITY 527 >AL139220-3|CAI19429.1| 692|Homo sapiens solute carrier family 6 (neurotransmitter transporter, glycine), member 9 protein. Length = 692 Score = 30.3 bits (65), Expect = 3.9 Identities = 6/30 (20%), Positives = 21/30 (70%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFLYALISYEALLF 105 ++++CW ++PA++ + ++ +I Y+ + + Sbjct: 557 FFQICWRFVSPAIIFFILVFTVIQYQPITY 586 >AL139220-2|CAI19428.1| 638|Homo sapiens solute carrier family 6 (neurotransmitter transporter, glycine), member 9 protein. Length = 638 Score = 30.3 bits (65), Expect = 3.9 Identities = 6/30 (20%), Positives = 21/30 (70%) Frame = +1 Query: 16 YWRMCWGLITPAMMIIVFLYALISYEALLF 105 ++++CW ++PA++ + ++ +I Y+ + + Sbjct: 503 FFQICWRFVSPAIIFFILVFTVIQYQPITY 532 >BC064348-1|AAH64348.1| 944|Homo sapiens chromosome 13 open reading frame 23 protein. Length = 944 Score = 29.1 bits (62), Expect = 9.0 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = -2 Query: 170 IGTNKIP--TINNR*PATYPAIPPKSNASYEISAYRNT-IIIMAGVIRP 33 +G +K P T N P YP P + +A+ SAY N ++ +A VI P Sbjct: 183 LGPSKPPPSTYNPHKPVPYPIPPCRPHATIAPSAYNNAGLVPLANVIAP 231 >BC053566-1|AAH53566.1| 781|Homo sapiens C13orf23 protein protein. Length = 781 Score = 29.1 bits (62), Expect = 9.0 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = -2 Query: 170 IGTNKIP--TINNR*PATYPAIPPKSNASYEISAYRNT-IIIMAGVIRP 33 +G +K P T N P YP P + +A+ SAY N ++ +A VI P Sbjct: 20 LGPSKPPPSTYNPHKPVPYPIPPCRPHATIAPSAYNNAGLVPLANVIAP 68 >AL445590-3|CAI40975.1| 944|Homo sapiens chromosome 13 open reading frame 23 protein. Length = 944 Score = 29.1 bits (62), Expect = 9.0 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = -2 Query: 170 IGTNKIP--TINNR*PATYPAIPPKSNASYEISAYRNT-IIIMAGVIRP 33 +G +K P T N P YP P + +A+ SAY N ++ +A VI P Sbjct: 183 LGPSKPPPSTYNPHKPVPYPIPPCRPHATIAPSAYNNAGLVPLANVIAP 231 >AK097051-1|BAC04935.1| 185|Homo sapiens protein ( Homo sapiens cDNA FLJ39732 fis, clone SMINT2015810. ). Length = 185 Score = 29.1 bits (62), Expect = 9.0 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = +3 Query: 252 LGPRSAGERRTWLSFKEDAKVLREKLNPSRITHVWYSLIGSYR 380 L PRS+ R W ++++ + ++KL TH+W L+G R Sbjct: 45 LEPRSS--RPVWAAWQDPLSIKKKKLAEYGGTHLWSQLLGRLR 85 >AB107354-1|BAC67659.1| 952|Homo sapiens KIAA2032 protein protein. Length = 952 Score = 29.1 bits (62), Expect = 9.0 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = -2 Query: 170 IGTNKIP--TINNR*PATYPAIPPKSNASYEISAYRNT-IIIMAGVIRP 33 +G +K P T N P YP P + +A+ SAY N ++ +A VI P Sbjct: 191 LGPSKPPPSTYNPHKPVPYPIPPCRPHATIAPSAYNNAGLVPLANVIAP 239 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,990,145 Number of Sequences: 237096 Number of extensions: 1515807 Number of successful extensions: 3087 Number of sequences better than 10.0: 61 Number of HSP's better than 10.0 without gapping: 2956 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3085 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4536472160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -