BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0697 (988 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30050| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_19823| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_7713| Best HMM Match : Lipase (HMM E-Value=0.0064) 40 0.003 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 38 0.017 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.017 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 38 0.017 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.017 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.017 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.017 SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) 38 0.017 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.017 SB_26408| Best HMM Match : Lipase (HMM E-Value=0) 37 0.022 SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) 37 0.029 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.051 SB_35408| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_5209| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 33 0.27 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 33 0.27 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.36 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.62 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.62 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.62 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 31 1.1 SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) 31 1.1 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_26132| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 31 1.9 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 31 1.9 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 31 1.9 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 30 2.5 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 30 2.5 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 30 2.5 SB_4480| Best HMM Match : TAT_ubiq (HMM E-Value=8.2) 30 2.5 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) 30 2.5 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 30 3.3 SB_742| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_38061| Best HMM Match : DUF995 (HMM E-Value=4) 29 4.4 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 29 4.4 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 29 4.4 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_9061| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 29 4.4 SB_3631| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_18140| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 29 4.4 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 29 4.4 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 29 5.8 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 29 5.8 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 29 5.8 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 29 5.8 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_14180| Best HMM Match : ERp29_N (HMM E-Value=3.4) 29 5.8 SB_13002| Best HMM Match : Ribonuc_2-5A (HMM E-Value=9.5) 29 5.8 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_526| Best HMM Match : GRP (HMM E-Value=8.5) 29 5.8 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 29 5.8 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 29 5.8 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 29 5.8 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 29 7.7 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 29 7.7 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_37859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_28095| Best HMM Match : bZIP_1 (HMM E-Value=0.59) 29 7.7 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_23182| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 29 7.7 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 29 7.7 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 29 7.7 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_44654| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 29 7.7 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 29 7.7 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_37530| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 29 7.7 SB_30062| Best HMM Match : Lipase_3 (HMM E-Value=1.7) 29 7.7 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) 29 7.7 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_22214| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 29 7.7 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 29 7.7 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_15081| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_7685| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 >SB_30050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 60.1 bits (139), Expect = 3e-09 Identities = 33/84 (39%), Positives = 46/84 (54%) Frame = +3 Query: 231 AYHLFTRSIXRXXSPLVLXSXNVLKASNYDEKKRTIILVHGWRNVATSNFNALLVPAFLQ 410 ++ LFTRS S + LKAS YD KKRT ++ HG+ ++++ + A LQ Sbjct: 71 SFQLFTRSHPHLVS-IDDSDVKKLKASTYDGKKRTFVIAHGYTESGSTSWVGHMRQALLQ 129 Query: 411 AEDXNVIIADWSIGAAGNYVVAPA 482 +D NV+I DW GA G Y A A Sbjct: 130 KDDVNVVITDWGPGADGMYWQATA 153 >SB_19823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 3/55 (5%) Frame = +1 Query: 508 LAXFIEWLNRTSGSKVSQYHLVGHSLGGHQXGIIGXXL---GGKVPYITSXDPAS 663 + I++LN +G+ + ++LVG SLG H G +G + G K+ IT DPAS Sbjct: 671 ITELIKFLNNQTGNTPASFYLVGFSLGAHISGYVGRRIAKTGQKLNRITGLDPAS 725 Score = 37.5 bits (83), Expect = 0.017 Identities = 19/41 (46%), Positives = 26/41 (63%) Frame = +3 Query: 234 YHLFTRSIXRXXSPLVLXSXNVLKASNYDEKKRTIILVHGW 356 + LFTRS + + + L+AS YD KKRTII+VHG+ Sbjct: 488 FRLFTRSNPLISNVIDDSDVSKLQASRYDGKKRTIIIVHGF 528 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 399 AFLQAEDXNVIIADWSIGAAGNYVVAPAXCF*IGPKL 509 A ++ ED NVI DWS GA Y A A +G ++ Sbjct: 635 ALIKQEDANVITTDWSRGATIPYEQATANTRMVGAQI 671 >SB_7713| Best HMM Match : Lipase (HMM E-Value=0.0064) Length = 131 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/46 (43%), Positives = 24/46 (52%) Frame = +1 Query: 508 LAXFIEWLNRTSGSKVSQYHLVGHSLGGHQXGIIGXXLGGKVPYIT 645 LA I + R + + HL+GHSLG H G G L GKV IT Sbjct: 85 LAELITTIQRVFDFDLRRVHLIGHSLGAHVAGYAGERLSGKVGRIT 130 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = +3 Query: 327 KRTIILVHGWRNVATSNFNALLVPAFLQAEDXNVIIADWSIGAAG 461 ++ ++++HG+ ++ ++ L+ E NVI DW GA G Sbjct: 23 RKLVLIIHGFMQSGNVSWIRVMRDELLKREPMNVITVDWQSGADG 67 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.5 bits (83), Expect = 0.017 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRLLQHTSL*Q*GPVKAGEPSLPA 133 RS TSGSPGLQEF +L+ L + GPV G+P +PA Sbjct: 11 RSRTSGSPGLQEFDIKLIDTVDL-EGGPV--GKPVVPA 45 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 37.5 bits (83), Expect = 0.017 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRLLQHTSL*Q*GPVKAGEPSLPA 133 RS TSGSPGLQEF +L+ L + GPV G+P +PA Sbjct: 11 RSRTSGSPGLQEFDIKLIDTVDL-EGGPV--GKPVVPA 45 >SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 92 Score = 37.5 bits (83), Expect = 0.017 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRLLQHTSL*Q*GPVKAGEPSLPA 133 RS TSGSPGLQEF +L+ L + GPV G+P +PA Sbjct: 11 RSRTSGSPGLQEFDIKLIDTVDL-EGGPV--GKPVVPA 45 >SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) Length = 142 Score = 37.5 bits (83), Expect = 0.017 Identities = 21/38 (55%), Positives = 25/38 (65%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRLLQHTSL*Q*GPVKAGEPSLPA 133 RS TSGSPGLQEF +L+ L + GPV G+P PA Sbjct: 11 RSRTSGSPGLQEFDIKLIDTVDL-EGGPV--GKPDAPA 45 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 37.5 bits (83), Expect = 0.017 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRLLQHTSL*Q*GPVKAGEPSLPA 133 RS TSGSPGLQEF +L+ L + GPV G+P +PA Sbjct: 106 RSRTSGSPGLQEFDIKLIDTVDL-EGGPV--GKPVVPA 140 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 37.5 bits (83), Expect = 0.017 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRLLQHTSL*Q*GPVKAGEPSLPA 133 RS TSGSPGLQEF +L+ L + GPV G+P +PA Sbjct: 11 RSRTSGSPGLQEFDIKLIDTVDL-EGGPV--GKPVVPA 45 >SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 127 Score = 37.5 bits (83), Expect = 0.017 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRLLQHTSL*Q*GPVKAGEPSLPA 133 RS TSGSPGLQEF +L+ L + GPV G+P +PA Sbjct: 11 RSRTSGSPGLQEFDIKLIDTVDL-EGGPV--GKPVVPA 45 >SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) Length = 119 Score = 37.5 bits (83), Expect = 0.017 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRLLQHTSL*Q*GPVKAGEPSLPA 133 RS TSGSPGLQEF +L+ L + GPV G+P +PA Sbjct: 11 RSRTSGSPGLQEFDIKLIDTVDL-EGGPV--GKPVVPA 45 >SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 142 Score = 37.5 bits (83), Expect = 0.017 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRLLQHTSL*Q*GPVKAGEPSLPA 133 RS TSGSPGLQEF +L+ L + GPV G+P +PA Sbjct: 11 RSRTSGSPGLQEFDIKLIDTVDL-EGGPV--GKPVVPA 45 >SB_26408| Best HMM Match : Lipase (HMM E-Value=0) Length = 714 Score = 37.1 bits (82), Expect = 0.022 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +1 Query: 511 AXFIEWLNRTSGSKVSQYHLVGHSLGGHQXGIIGXXL---GGKVPYITSXDPAS 663 A ++ L SG K++ H++G S G H G +G + G + IT+ DPA+ Sbjct: 174 ARLLQILEERSGRKLAYVHVIGFSFGAHVAGYVGRRMKKRGRMIDRITALDPAA 227 Score = 28.7 bits (61), Expect = 7.7 Identities = 16/62 (25%), Positives = 30/62 (48%), Gaps = 8/62 (12%) Frame = +3 Query: 294 NVLKASNYDEKKRTIILVHGWRNVATSN--------FNALLVPAFLQAEDXNVIIADWSI 449 ++ + ++++ +RT+I++HG+ T + + L D NVII DW Sbjct: 94 DITRDTHFNASRRTVIIIHGFAGFTTLTSIRHEVNWWGFPMKNELLWEGDFNVIIVDWMR 153 Query: 450 GA 455 GA Sbjct: 154 GA 155 >SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) Length = 126 Score = 36.7 bits (81), Expect = 0.029 Identities = 21/39 (53%), Positives = 24/39 (61%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRLLQHTSL*Q*GPVKAGEPSLPAR 136 RS TSGSPGLQEF T+ L HT + G V LP+R Sbjct: 11 RSRTSGSPGLQEFDTKGLLHTRM--DGNVTVDPTPLPSR 47 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.9 bits (79), Expect = 0.051 Identities = 20/38 (52%), Positives = 26/38 (68%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRLLQHTSL*Q*GPVKAGEPSLPA 133 RS TSGSPGLQEF +L+ L + GPV+ +P +PA Sbjct: 11 RSRTSGSPGLQEFDIKLIDTVDL-EGGPVR--KPVVPA 45 >SB_35408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 35.1 bits (77), Expect = 0.088 Identities = 23/58 (39%), Positives = 29/58 (50%), Gaps = 4/58 (6%) Frame = +2 Query: 20 RSXTSGSPGLQEF--GTRLLQHTSL*Q*GPVKAGEPSLPARPRVPDG--LPPRRSVAK 181 RS TSGSPGLQEF + P +P++P P +PD +P R VAK Sbjct: 11 RSRTSGSPGLQEFDPSDPTMPDDPTMPNDPTMPDDPTMPNDPTMPDDPTMPTRDVVAK 68 >SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.1 bits (77), Expect = 0.088 Identities = 20/38 (52%), Positives = 25/38 (65%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRLLQHTSL*Q*GPVKAGEPSLPA 133 RS TSGSPG QEF +L+ L + GPV G+P +PA Sbjct: 11 RSRTSGSPGQQEFDIKLIDTVDL-EGGPV--GKPVVPA 45 >SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/35 (48%), Positives = 20/35 (57%) Frame = -2 Query: 123 EGSPALTGPHCHRLVC*SSLVPNSCSPGXPLVXER 19 E +T H RL S+ + NSCSPG PLV ER Sbjct: 43 ENDDVITQVHSSRLRHGSNFLSNSCSPGDPLVLER 77 >SB_5209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +1 Query: 508 LAXFIEWLNRTSGSKVSQYHLVGHSLGGHQXGIIG 612 +A +++LN+ +G+ S + ++G SLGGH G G Sbjct: 1 IAELVKFLNKQTGNTPSSFTVIGFSLGGHVAGYAG 35 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 33.5 bits (73), Expect = 0.27 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = -2 Query: 117 SPALTGPHCHRLVC*SSLVPNSCSPGXPLVXER 19 SP + CH + + NSCSPG PLV ER Sbjct: 29 SPVVVTSGCHEWLSRVVVTSNSCSPGDPLVLER 61 >SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 33.5 bits (73), Expect = 0.27 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -2 Query: 90 HRLVC*SSLVPNSCSPGXPLVXER 19 H++V SS NSCSPG PLV ER Sbjct: 43 HKIVKSSSRASNSCSPGDPLVLER 66 >SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) Length = 142 Score = 33.5 bits (73), Expect = 0.27 Identities = 19/37 (51%), Positives = 24/37 (64%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRLLQHTSL*Q*GPVKAGEPSLP 130 RS TSGSPGLQEF +L+ L + GP G+P +P Sbjct: 11 RSRTSGSPGLQEFDIKLIDTVDL-EGGP--DGKPVVP 44 >SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) Length = 270 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -2 Query: 96 HCHRLVC*SSLVPNSCSPGXPLVXER 19 HC+ L + + NSCSPG PLV ER Sbjct: 135 HCNLLFSINLITSNSCSPGDPLVLER 160 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 33.1 bits (72), Expect = 0.36 Identities = 16/28 (57%), Positives = 17/28 (60%) Frame = -2 Query: 102 GPHCHRLVC*SSLVPNSCSPGXPLVXER 19 GP R SL+ NSCSPG PLV ER Sbjct: 22 GPPLLRSTVSISLISNSCSPGDPLVLER 49 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 32.3 bits (70), Expect = 0.62 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = -2 Query: 96 HCHRLVC*SSLVPNSCSPGXPLVXER 19 H H +C S + NSCSPG PLV ER Sbjct: 22 HEHVTIC-SYRISNSCSPGDPLVLER 46 >SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 32.3 bits (70), Expect = 0.62 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -2 Query: 84 LVC*SSLVPNSCSPGXPLVXER 19 ++C +++ NSCSPG PLV ER Sbjct: 13 IICSRTVLSNSCSPGDPLVLER 34 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.3 bits (70), Expect = 0.62 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -2 Query: 84 LVC*SSLVPNSCSPGXPLVXER 19 ++C L NSCSPG PLV ER Sbjct: 5 ILCTQELTSNSCSPGDPLVLER 26 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 SL+ NSCSPG PLV ER Sbjct: 32 SLISNSCSPGDPLVLER 48 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 SL+ NSCSPG PLV ER Sbjct: 32 SLISNSCSPGDPLVLER 48 >SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 31.9 bits (69), Expect = 0.82 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 4/30 (13%) Frame = -2 Query: 96 HCHRLVC*SSLVP----NSCSPGXPLVXER 19 HC ++ + L+P NSCSPG PLV ER Sbjct: 14 HCEKIQISNILIPKIASNSCSPGDPLVLER 43 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 SL+ NSCSPG PLV ER Sbjct: 32 SLISNSCSPGDPLVLER 48 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 SL+ NSCSPG PLV ER Sbjct: 32 SLISNSCSPGDPLVLER 48 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 SL+ NSCSPG PLV ER Sbjct: 32 SLISNSCSPGDPLVLER 48 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 SL+ NSCSPG PLV ER Sbjct: 32 SLISNSCSPGDPLVLER 48 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 SL+ NSCSPG PLV ER Sbjct: 32 SLISNSCSPGDPLVLER 48 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 31.9 bits (69), Expect = 0.82 Identities = 17/37 (45%), Positives = 19/37 (51%) Frame = -2 Query: 129 GSEGSPALTGPHCHRLVC*SSLVPNSCSPGXPLVXER 19 G + S G C L +V NSCSPG PLV ER Sbjct: 66 GEQNSNDRRGEECLTLT--QRIVSNSCSPGDPLVLER 100 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 SL+ NSCSPG PLV ER Sbjct: 32 SLISNSCSPGDPLVLER 48 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 SL+ NSCSPG PLV ER Sbjct: 30 SLISNSCSPGDPLVLER 46 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 S+V NSCSPG PLV ER Sbjct: 346 SIVSNSCSPGDPLVLER 362 >SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) Length = 141 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/20 (80%), Positives = 17/20 (85%), Gaps = 1/20 (5%) Frame = +2 Query: 20 RSXTSGSPGLQEF-GTRLLQ 76 RS TSGSPGLQEF TRLL+ Sbjct: 67 RSRTSGSPGLQEFDNTRLLR 86 >SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRLLQHTSL 88 RS TSGSPGLQEF +L+ L Sbjct: 11 RSRTSGSPGLQEFDIKLIDTVDL 33 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 S L+ NSCSPG PLV ER Sbjct: 15 SFLISNSCSPGDPLVLER 32 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +3 Query: 21 AXXLVXPPGCRNSARGC 71 A LV PPGCRNS GC Sbjct: 12 ALELVDPPGCRNSIEGC 28 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -2 Query: 78 C*SSLVPNSCSPGXPLVXER 19 C SL NSCSPG PLV ER Sbjct: 2 CHVSLSSNSCSPGDPLVLER 21 >SB_26132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -2 Query: 96 HCHRLVC*SSLVPNSCSPGXPLVXER 19 H C S + NSCSPG PLV ER Sbjct: 56 HTFGFFCYSFIGSNSCSPGDPLVLER 81 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 LV NSCSPG PLV ER Sbjct: 24 LVSNSCSPGDPLVLER 39 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 LV NSCSPG PLV ER Sbjct: 3 LVSNSCSPGDPLVLER 18 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 LV NSCSPG PLV ER Sbjct: 17 LVSNSCSPGDPLVLER 32 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTR 67 RS TSGSPGLQEF T+ Sbjct: 11 RSRTSGSPGLQEFDTK 26 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/38 (47%), Positives = 20/38 (52%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRLLQHTSL*Q*GPVKAGEPSLPA 133 RS TSGSPGLQEF T H G+P +PA Sbjct: 54 RSRTSGSPGLQEFDTCRDLHNDYTIIVDFGVGKPVVPA 91 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -2 Query: 81 VC*SSLVPNSCSPGXPLVXER 19 +C + V NSCSPG PLV ER Sbjct: 208 ICKTVNVSNSCSPGDPLVLER 228 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 +++V NSCSPG PLV ER Sbjct: 75 NTIVSNSCSPGDPLVLER 92 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 LV NSCSPG PLV ER Sbjct: 9 LVSNSCSPGDPLVLER 24 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 LV NSCSPG PLV ER Sbjct: 5 LVSNSCSPGDPLVLER 20 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 LV NSCSPG PLV ER Sbjct: 2 LVSNSCSPGDPLVLER 17 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 S V NSCSPG PLV ER Sbjct: 12 SFVSNSCSPGDPLVLER 28 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 LV NSCSPG PLV ER Sbjct: 26 LVSNSCSPGDPLVLER 41 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 +++V NSCSPG PLV ER Sbjct: 11 ANIVSNSCSPGDPLVLER 28 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 LV NSCSPG PLV ER Sbjct: 26 LVSNSCSPGDPLVLER 41 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 SL NSCSPG PLV ER Sbjct: 14 SLTSNSCSPGDPLVLER 30 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -2 Query: 78 C*SSLVPNSCSPGXPLVXER 19 C + ++ NSCSPG PLV ER Sbjct: 21 CHNIVISNSCSPGDPLVLER 40 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 S L NSCSPG PLV ER Sbjct: 9 SGLTSNSCSPGDPLVLER 26 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -2 Query: 90 HRLVC*SSLVPNSCSPGXPLVXER 19 HR S + NSCSPG PLV ER Sbjct: 92 HRQTNKSLKISNSCSPGDPLVLER 115 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 +S V NSCSPG PLV ER Sbjct: 12 ASQVSNSCSPGDPLVLER 29 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 L+ NSCSPG PLV ER Sbjct: 37 LISNSCSPGDPLVLER 52 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 +SL NSCSPG PLV ER Sbjct: 2 TSLSSNSCSPGDPLVLER 19 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 SS NSCSPG PLV ER Sbjct: 63 SSTTSNSCSPGDPLVLER 80 >SB_4480| Best HMM Match : TAT_ubiq (HMM E-Value=8.2) Length = 107 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/27 (55%), Positives = 19/27 (70%), Gaps = 4/27 (14%) Frame = +2 Query: 20 RSXTSGSPGLQEFG----TRLLQHTSL 88 RS TSGSPGLQEF R+L+H ++ Sbjct: 11 RSRTSGSPGLQEFDDEDINRILKHVNI 37 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 L+ NSCSPG PLV ER Sbjct: 8 LISNSCSPGDPLVLER 23 >SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) Length = 175 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 76 LKQPRAEFLQPGGXTSXXA 20 LK P+ EFLQPGG TS A Sbjct: 47 LKAPKIEFLQPGGSTSSRA 65 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 ++++ NSCSPG PLV ER Sbjct: 11 ANIISNSCSPGDPLVLER 28 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 30.3 bits (65), Expect = 2.5 Identities = 21/61 (34%), Positives = 25/61 (40%), Gaps = 6/61 (9%) Frame = +3 Query: 21 AXXLVXPPGCRNSARGCFSTPAYDNEVLLKLESP------RYQHVPGSRTVSHLEDLWLK 182 A LV PPGCRNS P D L L+ RYQ S + D W+K Sbjct: 12 ALELVDPPGCRNSILDPSPLPYLDPSPLPYLDPSRDAVVLRYQPPCASVMIDRQHDCWIK 71 Query: 183 V 185 + Sbjct: 72 L 72 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 L+ NSCSPG PLV ER Sbjct: 24 LISNSCSPGDPLVLER 39 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 S++ NSCSPG PLV ER Sbjct: 2419 SAIASNSCSPGDPLVLER 2436 >SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -2 Query: 84 LVC*SSLVPNSCSPGXPLVXER 19 LV S+ NSCSPG PLV ER Sbjct: 28 LVYYRSITSNSCSPGDPLVLER 49 >SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 SS+ NSCSPG PLV ER Sbjct: 2 SSIGSNSCSPGDPLVLER 19 >SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 S++ NSCSPG PLV ER Sbjct: 44 STITSNSCSPGDPLVLER 61 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 L+ NSCSPG PLV ER Sbjct: 40 LISNSCSPGDPLVLER 55 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 L+ NSCSPG PLV ER Sbjct: 70 LISNSCSPGDPLVLER 85 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 L+ NSCSPG PLV ER Sbjct: 21 LISNSCSPGDPLVLER 36 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 S L+ NSCSPG PLV ER Sbjct: 5 SFLLSNSCSPGDPLVLER 22 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 L+ NSCSPG PLV ER Sbjct: 16 LISNSCSPGDPLVLER 31 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 ++++ NSCSPG PLV ER Sbjct: 11 ANIISNSCSPGDPLVLER 28 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 S ++ NSCSPG PLV ER Sbjct: 24 SLIISNSCSPGDPLVLER 41 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/21 (71%), Positives = 16/21 (76%), Gaps = 3/21 (14%) Frame = -2 Query: 72 SSLVP---NSCSPGXPLVXER 19 +SLVP NSCSPG PLV ER Sbjct: 20 ASLVPRPSNSCSPGDPLVLER 40 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 S V NSCSPG PLV ER Sbjct: 4 SDRVSNSCSPGDPLVLER 21 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 +L+ NSCSPG PLV ER Sbjct: 61 TLLSNSCSPGDPLVLER 77 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 ++L NSCSPG PLV ER Sbjct: 13 TALTSNSCSPGDPLVLER 30 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -2 Query: 84 LVC*SSLVPNSCSPGXPLVXER 19 L+ S + NSCSPG PLV ER Sbjct: 52 LIVVPSSISNSCSPGDPLVLER 73 >SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -2 Query: 96 HCHRLVC*SSLVPNSCSPGXPLVXER 19 HC + NSCSPG PLV ER Sbjct: 69 HCRKQRSREVATSNSCSPGDPLVLER 94 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -2 Query: 84 LVC*SSLVPNSCSPGXPLVXER 19 L+ + +V NSCSPG PLV ER Sbjct: 3468 LIYVARVVSNSCSPGDPLVLER 3489 >SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -2 Query: 96 HCHRLVC*SSLVPNSCSPGXPLVXER 19 +C ++ NSCSPG PLV ER Sbjct: 10 NCENIITLQEKKSNSCSPGDPLVLER 35 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -2 Query: 84 LVC*SSLVPNSCSPGXPLVXER 19 L+ + ++ NSCSPG PLV ER Sbjct: 8 LISANIIISNSCSPGDPLVLER 29 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 ++L NSCSPG PLV ER Sbjct: 4 NTLASNSCSPGDPLVLER 21 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 +L+ NSCSPG PLV ER Sbjct: 1 TLLSNSCSPGDPLVLER 17 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 +V NSCSPG PLV ER Sbjct: 11 MVSNSCSPGDPLVLER 26 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 +V NSCSPG PLV ER Sbjct: 1 MVSNSCSPGDPLVLER 16 >SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 29.9 bits (64), Expect = 3.3 Identities = 20/43 (46%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRLLQHTSL*Q*GPV--KAGEPSLPARPR 142 RS TSGSPGLQEF L + + P+ K + S PAR R Sbjct: 11 RSRTSGSPGLQEFDISNLVNYVGRRNSPIQEKGAKSSDPARTR 53 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 ++V NSCSPG PLV ER Sbjct: 18 TVVSNSCSPGDPLVLER 34 >SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 29.9 bits (64), Expect = 3.3 Identities = 20/47 (42%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -2 Query: 156 RPSGTLGRAGSEGSPALTG-PHCHRLVC*SSLVPNSCSPGXPLVXER 19 R L + G +G L P R +C S NSCSPG PLV ER Sbjct: 8 RQRTVLRQKGRQGKSVLVSVPQGLRKLCES----NSCSPGDPLVLER 50 >SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 20 RSXTSGSPGLQEFGT 64 RS TSGSPGLQEF T Sbjct: 11 RSRTSGSPGLQEFDT 25 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 S V NSCSPG PLV ER Sbjct: 15 SKVSNSCSPGDPLVLER 31 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 +++ NSCSPG PLV ER Sbjct: 3 TIISNSCSPGDPLVLER 19 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 +V NSCSPG PLV ER Sbjct: 6 IVSNSCSPGDPLVLER 21 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 +V NSCSPG PLV ER Sbjct: 1 MVSNSCSPGDPLVLER 16 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 +S + NSCSPG PLV ER Sbjct: 3 TSKISNSCSPGDPLVLER 20 >SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) Length = 144 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 S+ NSCSPG PLV ER Sbjct: 18 SITSNSCSPGDPLVLER 34 >SB_742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRLL 73 RS TSGSPGLQEF LL Sbjct: 11 RSRTSGSPGLQEFDEYLL 28 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 ++ NSCSPG PLV ER Sbjct: 17 IISNSCSPGDPLVLER 32 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 +S NSCSPG PLV ER Sbjct: 11 TSFTSNSCSPGDPLVLER 28 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 ++++ NSCSPG PLV ER Sbjct: 11 ANILSNSCSPGDPLVLER 28 >SB_38061| Best HMM Match : DUF995 (HMM E-Value=4) Length = 220 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTR 67 RS TSGSPGLQEF R Sbjct: 11 RSRTSGSPGLQEFDMR 26 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 ++ NSCSPG PLV ER Sbjct: 119 IISNSCSPGDPLVLER 134 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 S++ NSCSPG PLV ER Sbjct: 19 SNISSNSCSPGDPLVLER 36 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRLL 73 RS TSGSPGLQEF +++ Sbjct: 11 RSRTSGSPGLQEFDMKIV 28 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -2 Query: 84 LVC*SSLVPNSCSPGXPLVXER 19 L+ + ++ NSCSPG PLV ER Sbjct: 8 LISANIVISNSCSPGDPLVLER 29 >SB_9061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTR 67 RS TSGSPGLQEF R Sbjct: 11 RSRTSGSPGLQEFDLR 26 >SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) Length = 106 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 Query: 21 AXXLVXPPGCRNSARGCFSTPA 86 A LV PPGCRNS + F T A Sbjct: 12 ALELVDPPGCRNSMKQRFKTKA 33 >SB_3631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTR 67 RS TSGSPGLQEF R Sbjct: 11 RSRTSGSPGLQEFDKR 26 >SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRL 70 RS TSGSPGLQEF +L Sbjct: 11 RSRTSGSPGLQEFDQQL 27 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 S + NSCSPG PLV ER Sbjct: 2 SQISNSCSPGDPLVLER 18 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 +V NSCSPG PLV ER Sbjct: 7 VVSNSCSPGDPLVLER 22 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 L+ NSCSPG PLV ER Sbjct: 54 LLSNSCSPGDPLVLER 69 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 + V NSCSPG PLV ER Sbjct: 17 AFVSNSCSPGDPLVLER 33 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 L+ NSCSPG PLV ER Sbjct: 6 LLSNSCSPGDPLVLER 21 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 ++ NSCSPG PLV ER Sbjct: 5 IISNSCSPGDPLVLER 20 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 S V NSCSPG PLV ER Sbjct: 38 SENVSNSCSPGDPLVLER 55 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 +++ NSCSPG PLV ER Sbjct: 4 NVISNSCSPGDPLVLER 20 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 ++ NSCSPG PLV ER Sbjct: 1 MISNSCSPGDPLVLER 16 >SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 S+ NSCSPG PLV ER Sbjct: 6 SVTSNSCSPGDPLVLER 22 >SB_18140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRLLQHT 82 RS TSGSPGLQEF + Q T Sbjct: 11 RSRTSGSPGLQEFDVKHHQGT 31 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 L+ NSCSPG PLV ER Sbjct: 1 LLSNSCSPGDPLVLER 16 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/17 (82%), Positives = 14/17 (82%), Gaps = 1/17 (5%) Frame = -2 Query: 66 LVP-NSCSPGXPLVXER 19 LVP NSCSPG PLV ER Sbjct: 27 LVPSNSCSPGDPLVLER 43 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 +L NSCSPG PLV ER Sbjct: 2 TLASNSCSPGDPLVLER 18 >SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) Length = 781 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 SS NSCSPG PLV ER Sbjct: 512 SSTPSNSCSPGDPLVLER 529 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 +V NSCSPG PLV ER Sbjct: 27 VVSNSCSPGDPLVLER 42 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 + V NSCSPG PLV ER Sbjct: 14 ADFVSNSCSPGDPLVLER 31 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 +L NSCSPG PLV ER Sbjct: 95 ALASNSCSPGDPLVLER 111 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 +++ NSCSPG PLV ER Sbjct: 11 ANIASNSCSPGDPLVLER 28 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 30 VSNSCSPGDPLVLER 44 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -1 Query: 82 GVLKQPRAEFLQPGGXTSXXA 20 G+L P EFLQPGG TS A Sbjct: 70 GLLNPPCIEFLQPGGSTSSRA 90 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRLLQHT 82 RS TSGSPGLQEF ++HT Sbjct: 11 RSRTSGSPGLQEFDHN-IRHT 30 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 10 VSNSCSPGDPLVLER 24 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 90 HRLVC*SSLVPNSCSPGXPLVXER 19 HR+ + NSCSPG PLV ER Sbjct: 153 HRVSALPPHLSNSCSPGDPLVLER 176 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 29.1 bits (62), Expect = 5.8 Identities = 18/34 (52%), Positives = 22/34 (64%), Gaps = 6/34 (17%) Frame = -2 Query: 102 GPH--CHRLV--C*SSL-VP-NSCSPGXPLVXER 19 GPH C++++ C VP NSCSPG PLV ER Sbjct: 23 GPHQDCNKMLGLCLKQANVPSNSCSPGDPLVLER 56 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 2 VSNSCSPGDPLVLER 16 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 +S NSCSPG PLV ER Sbjct: 11 NSTASNSCSPGDPLVLER 28 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 29.1 bits (62), Expect = 5.8 Identities = 15/19 (78%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = +2 Query: 20 RSXTSGSPGLQEF--GTRL 70 RS TSGSPGLQEF G RL Sbjct: 11 RSRTSGSPGLQEFDIGVRL 29 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 40 VSNSCSPGDPLVLER 54 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 117 VSNSCSPGDPLVLER 131 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 184 VSNSCSPGDPLVLER 198 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 34 VSNSCSPGDPLVLER 48 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 1066 VSNSCSPGDPLVLER 1080 >SB_14180| Best HMM Match : ERp29_N (HMM E-Value=3.4) Length = 153 Score = 29.1 bits (62), Expect = 5.8 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRLLQHTSL*Q*GPVKAGE 118 RS TSGSPGLQEF L L + G G+ Sbjct: 11 RSRTSGSPGLQEFDVYLTTRRILYELGAPLPGD 43 >SB_13002| Best HMM Match : Ribonuc_2-5A (HMM E-Value=9.5) Length = 91 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTR 67 RS TSGSPGLQEF R Sbjct: 11 RSRTSGSPGLQEFDHR 26 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 L NSCSPG PLV ER Sbjct: 78 LTSNSCSPGDPLVLER 93 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 3 VSNSCSPGDPLVLER 17 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 32 VSNSCSPGDPLVLER 46 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 L NSCSPG PLV ER Sbjct: 5 LASNSCSPGDPLVLER 20 >SB_526| Best HMM Match : GRP (HMM E-Value=8.5) Length = 149 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRL 70 RS TSGSPGLQEF L Sbjct: 11 RSRTSGSPGLQEFDATL 27 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 5 VSNSCSPGDPLVLER 19 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 3 VSNSCSPGDPLVLER 17 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 7 VSNSCSPGDPLVLER 21 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 64 VSNSCSPGDPLVLER 78 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 4 VSNSCSPGDPLVLER 18 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 4 VSNSCSPGDPLVLER 18 >SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 +++ NSCSPG PLV ER Sbjct: 11 ANITSNSCSPGDPLVLER 28 >SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 +S + NSCSPG PLV ER Sbjct: 4 NSQLSNSCSPGDPLVLER 21 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 11 VSNSCSPGDPLVLER 25 >SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.1 bits (62), Expect = 5.8 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 99 PHCHRLVC*SSLVPNSCSPGXPLVXER 19 PH HR NSCSPG PLV ER Sbjct: 9 PHIHR-------ASNSCSPGDPLVLER 28 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 25 VSNSCSPGDPLVLER 39 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 15 VSNSCSPGDPLVLER 29 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 L NSCSPG PLV ER Sbjct: 17 LASNSCSPGDPLVLER 32 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 10 VSNSCSPGDPLVLER 24 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 59 VSNSCSPGDPLVLER 73 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 31 VSNSCSPGDPLVLER 45 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 4 VSNSCSPGDPLVLER 18 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 15 VSNSCSPGDPLVLER 29 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 4 VSNSCSPGDPLVLER 18 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 6 VSNSCSPGDPLVLER 20 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 15 VSNSCSPGDPLVLER 29 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 L NSCSPG PLV ER Sbjct: 37 LTSNSCSPGDPLVLER 52 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 18 VSNSCSPGDPLVLER 32 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 L NSCSPG PLV ER Sbjct: 20 LASNSCSPGDPLVLER 35 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 30 VSNSCSPGDPLVLER 44 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 32 VSNSCSPGDPLVLER 46 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 10 VSNSCSPGDPLVLER 24 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 14 VSNSCSPGDPLVLER 28 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 34 VSNSCSPGDPLVLER 48 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 L NSCSPG PLV ER Sbjct: 88 LTSNSCSPGDPLVLER 103 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 L NSCSPG PLV ER Sbjct: 11 LASNSCSPGDPLVLER 26 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 ++ NSCSPG PLV ER Sbjct: 17 VISNSCSPGDPLVLER 32 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 + + NSCSPG PLV ER Sbjct: 50 AFISNSCSPGDPLVLER 66 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 8 VSNSCSPGDPLVLER 22 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 10 VSNSCSPGDPLVLER 24 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 23 VSNSCSPGDPLVLER 37 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 18 VSNSCSPGDPLVLER 32 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 L NSCSPG PLV ER Sbjct: 11 LASNSCSPGDPLVLER 26 >SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -1 Query: 106 NRTSLS*AGVLKQPRAEFLQPGGXTSXXA 20 +R SL A + + EFLQPGG TS A Sbjct: 15 SRVSLDPAAKTRSAKIEFLQPGGSTSSRA 43 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 L NSCSPG PLV ER Sbjct: 661 LASNSCSPGDPLVLER 676 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 27 VSNSCSPGDPLVLER 41 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 L NSCSPG PLV ER Sbjct: 7 LASNSCSPGDPLVLER 22 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 193 VSNSCSPGDPLVLER 207 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 9 VSNSCSPGDPLVLER 23 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 L NSCSPG PLV ER Sbjct: 4 LASNSCSPGDPLVLER 19 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 V NSCSPG PLV ER Sbjct: 10 VSNSCSPGDPLVLER 24 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 5 ISNSCSPGDPLVLER 19 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 28.7 bits (61), Expect = 7.7 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 S NSCSPG PLV ER Sbjct: 78 SRFTSNSCSPGDPLVLER 95 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 28.7 bits (61), Expect = 7.7 Identities = 22/48 (45%), Positives = 24/48 (50%) Frame = -2 Query: 162 GGRPSGTLGRAGSEGSPALTGPHCHRLVC*SSLVPNSCSPGXPLVXER 19 GG T A S G PA+ G L+ S NSCSPG PLV ER Sbjct: 3 GGAEGHTAILARSLGLPAVLG--APELLTAS----NSCSPGDPLVLER 44 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 261 ISNSCSPGDPLVLER 275 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 16 ISNSCSPGDPLVLER 30 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 28.7 bits (61), Expect = 7.7 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 S+ NSCSPG PLV ER Sbjct: 110 SVESNSCSPGDPLVLER 126 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 ++ NSCSPG PLV ER Sbjct: 36 NIASNSCSPGDPLVLER 52 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.7 bits (61), Expect = 7.7 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 S NSCSPG PLV ER Sbjct: 17 SQTASNSCSPGDPLVLER 34 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 28.7 bits (61), Expect = 7.7 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 +L NSCSPG PLV ER Sbjct: 22 ALSSNSCSPGDPLVLER 38 >SB_37859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 28.7 bits (61), Expect = 7.7 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRLL 73 RS TSGSPGLQEF +L Sbjct: 11 RSRTSGSPGLQEFDELVL 28 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 21 ISNSCSPGDPLVLER 35 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 + ++ NSCSPG PLV ER Sbjct: 10 TKVLSNSCSPGDPLVLER 27 >SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 17 ISNSCSPGEPLVLER 31 >SB_28095| Best HMM Match : bZIP_1 (HMM E-Value=0.59) Length = 160 Score = 28.7 bits (61), Expect = 7.7 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTR 67 RS TSGSPGLQEF + Sbjct: 11 RSRTSGSPGLQEFDNK 26 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 9 ISNSCSPGDPLVLER 23 >SB_23182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 28.7 bits (61), Expect = 7.7 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRL 70 RS TSGSPGLQEF L Sbjct: 11 RSRTSGSPGLQEFDLSL 27 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 10 ISNSCSPGDPLVLER 24 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 3 ISNSCSPGDPLVLER 17 >SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 7.7 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 S + NSCSPG PLV ER Sbjct: 39 SFFLSNSCSPGDPLVLER 56 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 ++ NSCSPG PLV ER Sbjct: 55 ILSNSCSPGDPLVLER 70 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 13 ISNSCSPGDPLVLER 27 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 4 ISNSCSPGDPLVLER 18 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 52 ISNSCSPGDPLVLER 66 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 51 ISNSCSPGDPLVLER 65 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 16 ISNSCSPGDPLVLER 30 >SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) Length = 428 Score = 28.7 bits (61), Expect = 7.7 Identities = 15/30 (50%), Positives = 16/30 (53%), Gaps = 5/30 (16%) Frame = -2 Query: 93 CHRLVC*SSLV-----PNSCSPGXPLVXER 19 CHR C + NSCSPG PLV ER Sbjct: 145 CHRCECRMEGINCEVGSNSCSPGDPLVLER 174 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 21 ISNSCSPGDPLVLER 35 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 152 ISNSCSPGDPLVLER 166 >SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.7 bits (61), Expect = 7.7 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 72 SSLVPNSCSPGXPLVXER 19 + L NSCSPG PLV ER Sbjct: 4 TGLPSNSCSPGDPLVLER 21 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 47 ISNSCSPGDPLVLER 61 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 7 ISNSCSPGDPLVLER 21 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 4 ISNSCSPGDPLVLER 18 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 32 ISNSCSPGDPLVLER 46 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 18 ISNSCSPGDPLVLER 32 >SB_44654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 28.7 bits (61), Expect = 7.7 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTRLL 73 RS TSGSPGLQEF +L Sbjct: 11 RSRTSGSPGLQEFDDFIL 28 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 974 ISNSCSPGDPLVLER 988 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 6 ISNSCSPGDPLVLER 20 >SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 69 SLVPNSCSPGXPLVXER 19 ++ NSCSPG PLV ER Sbjct: 3 TIASNSCSPGDPLVLER 19 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 66 LVPNSCSPGXPLVXER 19 ++ NSCSPG PLV ER Sbjct: 65 MLSNSCSPGDPLVLER 80 >SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 1 ISNSCSPGDPLVLER 15 >SB_37530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 28.7 bits (61), Expect = 7.7 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +2 Query: 20 RSXTSGSPGLQEFGTR 67 RS TSGSPGLQEF + Sbjct: 11 RSRTSGSPGLQEFDAK 26 >SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 5 ISNSCSPGDPLVLER 19 >SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 5 ISNSCSPGDPLVLER 19 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 63 VPNSCSPGXPLVXER 19 + NSCSPG PLV ER Sbjct: 32 ISNSCSPGDPLVLER 46 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,940,280 Number of Sequences: 59808 Number of extensions: 499260 Number of successful extensions: 2828 Number of sequences better than 10.0: 281 Number of HSP's better than 10.0 without gapping: 2624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2824 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2931631446 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -