BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0693 (426 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35685| Best HMM Match : Ribosomal_S8 (HMM E-Value=0.08) 75 2e-14 SB_54474| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 >SB_35685| Best HMM Match : Ribosomal_S8 (HMM E-Value=0.08) Length = 120 Score = 74.9 bits (176), Expect = 2e-14 Identities = 46/79 (58%), Positives = 52/79 (65%), Gaps = 1/79 (1%) Frame = +1 Query: 13 MVRMNVXRDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMKHGYIGEFEIVDDHRAGK 192 MVR+NV DAL SI NAEKRGKRQV IRP SKVIVKFLTVMMKH V R G+ Sbjct: 1 MVRVNVLNDALVSICNAEKRGKRQVQIRPSSKVIVKFLTVMMKH--------VAQPRIGE 52 Query: 193 IVVN-LTGRLNKCGVISPR 246 +V +G L+ GV+ R Sbjct: 53 MVTRPCSGALSAAGVVVTR 71 >SB_54474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 28.7 bits (61), Expect = 2.1 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +1 Query: 46 KSIHNAEKRGKRQVLIRPCSKVIVKFL--TVMMKHGYIGEFEIV 171 K+IHN RGKR +++ V F TV+M++G F++V Sbjct: 17 KNIHNVNVRGKRGNIVQVYPAVEYDFTPNTVLMRNGDYVHFQLV 60 >SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 29 Score = 28.7 bits (61), Expect = 2.1 Identities = 12/17 (70%), Positives = 15/17 (88%), Gaps = 1/17 (5%) Frame = +3 Query: 258 INDIERW-TNLLPSRQF 305 + DIE+W +NLLPSRQF Sbjct: 12 VRDIEQWASNLLPSRQF 28 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,988,388 Number of Sequences: 59808 Number of extensions: 228775 Number of successful extensions: 1061 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1047 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1061 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 814166562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -