BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0690 (722 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0737 + 10820728-10821096,10821320-10821532,10821631-108217... 31 0.93 08_01_0680 - 5958066-5960253,5960707-5961503 30 1.6 04_04_1115 + 31008213-31008707,31009385-31009689,31010848-310111... 28 6.5 09_06_0061 + 20596360-20596618,20597039-20597158,20597329-205974... 28 8.6 06_01_0225 - 1727461-1728825 28 8.6 03_02_0344 - 7654551-7656149 28 8.6 >03_02_0737 + 10820728-10821096,10821320-10821532,10821631-10821732, 10821755-10821793,10821830-10821967,10822182-10822486, 10822784-10822937,10823279-10823404 Length = 481 Score = 31.1 bits (67), Expect = 0.93 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 507 GAGGWPCASGPWSPR 463 G GG P A+GPWSPR Sbjct: 47 GRGGLPAAAGPWSPR 61 >08_01_0680 - 5958066-5960253,5960707-5961503 Length = 994 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = -2 Query: 247 AGQLIRTTFCCHRLN--FLHEHVICVIQSPYHPLAQSVRLVTVLYA 116 A LIR +F CHR++ FL H++ ++ S + + L+ LYA Sbjct: 935 ANSLIRHSFTCHRVSALFLLNHILAILFSKFILCISVLSLLFWLYA 980 >04_04_1115 + 31008213-31008707,31009385-31009689,31010848-31011108, 31011193-31011401,31011490-31011783,31011861-31011901, 31011987-31012055,31012164-31012264,31012351-31012435, 31012539-31012637,31012731-31012799,31012909-31013040, 31013128-31013222,31013340-31013421 Length = 778 Score = 28.3 bits (60), Expect = 6.5 Identities = 19/61 (31%), Positives = 27/61 (44%) Frame = -1 Query: 194 RTRHMCDTKPVSPSGAVRTFGNCSLCAIYLVNLGDFYSTCCIWISKTTHASSERRSFCLY 15 R RH C P+ G++ + G C AI +L DF C + S+ RS CL Sbjct: 289 RKRHRCVVVPI---GSL-SIGFCRHRAILFKSLADFIGLPCRIAQGCKYCSAPHRSSCLV 344 Query: 14 R 12 + Sbjct: 345 K 345 >09_06_0061 + 20596360-20596618,20597039-20597158,20597329-20597462, 20597578-20597730,20597816-20597927,20598022-20598352, 20598524-20598737,20598842-20598931,20599669-20599924, 20600029-20600141,20600733-20600831,20600915-20600980, 20601018-20601167,20601278-20601368,20601710-20601749, 20603888-20605247,20605478-20605507,20605834-20605885, 20606264-20606397,20606513-20606665,20607089-20607202 Length = 1356 Score = 27.9 bits (59), Expect = 8.6 Identities = 17/59 (28%), Positives = 28/59 (47%) Frame = -1 Query: 224 LLLSSFELSSRTRHMCDTKPVSPSGAVRTFGNCSLCAIYLVNLGDFYSTCCIWISKTTH 48 L+ + E+ R R++ + S S A GN ++ +L D+ +C I SK TH Sbjct: 1273 LIFTEEEVEYRVRNVLASVESSLSNASYLSGNPPEIVVWSASLYDYKISCAIDASKRTH 1331 >06_01_0225 - 1727461-1728825 Length = 454 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -2 Query: 406 RTWVSWSGLASILPSSVIKSCVLVRSFIWSFLNLK*TAQ 290 R WV+W + +L VI C ++ +WS NL+ A+ Sbjct: 320 RAWVTWKQV--LLLVDVICCCAVLFPIVWSIKNLREAAR 356 >03_02_0344 - 7654551-7656149 Length = 532 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 381 NPDQDTQVLQVTCRNFHEVPPLMGMILSSVTM 476 NP +D +L V C F+ P L MI++ M Sbjct: 210 NPKRDVGILIVNCSLFNPTPSLSSMIINHYEM 241 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,064,460 Number of Sequences: 37544 Number of extensions: 476811 Number of successful extensions: 1333 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1281 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1333 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1886372480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -