BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0688 (727 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g09620.1 68418.m01113 octicosapeptide/Phox/Bem1p (PB1) domain... 30 1.8 At4g30180.1 68417.m04291 expressed protein 29 2.4 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 29 3.1 At4g13800.1 68417.m02139 permease-related contains 9 predicted t... 29 3.1 At5g57180.2 68418.m07143 expressed protein ; supporting cDNA gi|... 29 4.1 At5g57180.1 68418.m07142 expressed protein ; supporting cDNA gi|... 29 4.1 At4g07470.1 68417.m01149 hypothetical protein 28 7.2 At5g22890.1 68418.m02677 zinc finger (C2H2 type) family protein ... 27 9.6 At5g10380.1 68418.m01204 zinc finger (C3HC4-type RING finger) fa... 27 9.6 At1g73500.1 68414.m08509 mitogen-activated protein kinase kinase... 27 9.6 >At5g09620.1 68418.m01113 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein predicted proteins, Arabidopsis thaliana and Drosophila melanogaster contains Pfam profile PF00564: PB1 domain Length = 531 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = +3 Query: 432 HNDVAIINHNHVGFTNNIQRINLASGATTLLVLGPGLPASEGPPMLLREP 581 H D + N G+ + + G + +GP + S GPPM L+EP Sbjct: 415 HPDAYMEQQNQPGYNVVQPQPTFSGGPQVMTSVGPQVMTSVGPPMGLQEP 464 >At4g30180.1 68417.m04291 expressed protein Length = 158 Score = 29.5 bits (63), Expect = 2.4 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 24 SSQQY*WRWRPWSWQKSPSNSTTTSRSVSPGPRVLDAPRK 143 S+Q++ W S SN TTT+ S S G R+L+ P K Sbjct: 62 SAQEFAWSRFLLQKLSSSSNPTTTTSSSSDGIRILERPDK 101 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 29.1 bits (62), Expect = 3.1 Identities = 18/45 (40%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +3 Query: 543 PASEGPPMLLREPTTNKNAK*ASRSLP-TPSAPARLETM*SLPPP 674 P PP PT N A +S P P AP RL T + PPP Sbjct: 728 PPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPP 772 >At4g13800.1 68417.m02139 permease-related contains 9 predicted transmembrane domains; contains Pfam PF05653: Protein of unknown function (DUF803); identified as COG0697, Permeases of the drug/metabolite transporter (DMT) superfamily Length = 336 Score = 29.1 bits (62), Expect = 3.1 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -1 Query: 223 HKSSKMGVSTSVCGRTTHNPGTVEVSGFLGASKT 122 HK+ MG STS+ G T+H+P V G+S++ Sbjct: 294 HKTKDMGNSTSLRGSTSHSPRDTPVFINSGSSRS 327 >At5g57180.2 68418.m07143 expressed protein ; supporting cDNA gi|13991645|gb|AF359387.1|AF359387 Length = 435 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 75 PSNSTTTSRSVSPGPRVLDAPRKPL 149 PS+STTT+R+ SP + ++ PL Sbjct: 27 PSSSTTTTRATSPSSTISESSNSPL 51 >At5g57180.1 68418.m07142 expressed protein ; supporting cDNA gi|13991645|gb|AF359387.1|AF359387 Length = 424 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 75 PSNSTTTSRSVSPGPRVLDAPRKPL 149 PS+STTT+R+ SP + ++ PL Sbjct: 27 PSSSTTTTRATSPSSTISESSNSPL 51 >At4g07470.1 68417.m01149 hypothetical protein Length = 150 Score = 27.9 bits (59), Expect = 7.2 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 163 QDCGWFCRKRWCSPPSCWTCDRTDEWQN 246 +DCG+ KRWC+ P C D+ E +N Sbjct: 85 RDCGF---KRWCAVPLCDEFDKIKEEKN 109 >At5g22890.1 68418.m02677 zinc finger (C2H2 type) family protein contains Pfam domain PF00096: Zinc finger, C2H2 type Length = 373 Score = 27.5 bits (58), Expect = 9.6 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = +3 Query: 366 SGGTRVTTSNVQMHGSYNMDTLHNDVAIINHNHVGFTNNIQRINLASGATTLLVLGPG 539 +G + +V + YN+ TLH V I + + IN +SG+T+L V G Sbjct: 42 TGTKSMEDDDVSLSLLYNLSTLHEKVHQIQSLVSFYMVSTNNINQSSGSTSLAVANIG 99 >At5g10380.1 68418.m01204 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 301 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 535 LGCRLRKDLRCCFGSQQPTKTPSEPP 612 L C KDLR CF P P PP Sbjct: 10 LSCLQFKDLRFCFRQYPPPPPPPPPP 35 >At1g73500.1 68414.m08509 mitogen-activated protein kinase kinase (MAPKK), putative (MKK9) mitogen-activated protein kinase kinase (MAPKK) family, PMID:12119167 Length = 310 Score = 27.5 bits (58), Expect = 9.6 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +2 Query: 587 QQKRQVSLQVITNAVCARTFGNNVIIASTLCVDGSNGRSTC 709 +++RQ++L++ + R F + A+T V G NG S C Sbjct: 5 RERRQLNLRLPLPPISDRRFSTSSSSATTTTVAGCNGISAC 45 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,673,394 Number of Sequences: 28952 Number of extensions: 282125 Number of successful extensions: 1173 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1170 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1584903024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -