BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0682 (726 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical pro... 25 0.47 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 25 0.83 >AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical protein protein. Length = 102 Score = 25.4 bits (53), Expect = 0.47 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 255 MKIRFCIFIHSRRINRCNFSQF 320 M R CI I S R N NFS+F Sbjct: 1 MSTRICIPISSGRTNGSNFSKF 22 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 24.6 bits (51), Expect = 0.83 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = -1 Query: 606 LMKKLYFMKYMSLDNLNIVEVFQLNLKNVVEKIYIYSNKYCK 481 + + Y++ MS L +FQ N N+V ++ +Y K Sbjct: 61 ISENFYYLPAMSTGPLKYA-IFQKNFTNIVNLTHLLETQYAK 101 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,945 Number of Sequences: 336 Number of extensions: 1809 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19363530 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -