BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0678 (531 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subu... 24 0.73 AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 24 0.96 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 5.1 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 8.9 AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 21 8.9 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 21 8.9 >S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subunit protein. Length = 141 Score = 24.2 bits (50), Expect = 0.73 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 232 KWRLHPRSVSVGDKVLLPEY 291 KW P SV V ++V LP++ Sbjct: 16 KWNEGPNSVGVSNEVSLPQF 35 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 23.8 bits (49), Expect = 0.96 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 232 KWRLHPRSVSVGDKVLLPEY 291 KW P SV V +V LP++ Sbjct: 198 KWNEGPNSVGVSSEVSLPQF 217 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.4 bits (43), Expect = 5.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 101 EEEPIVLLHWPFRFL 57 EE P V + PFRFL Sbjct: 485 EERPDVKIFLPFRFL 499 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 20.6 bits (41), Expect = 8.9 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +1 Query: 67 NGQCSKTIGSSSGPCPDQKS*SYNQNCRRHCHPREGSIQG 186 +GQ +T+G +S P + + SY + RE QG Sbjct: 711 HGQWERTVGHNSPLFPLESATSYQKKLTVDFSAREWVKQG 750 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 20.6 bits (41), Expect = 8.9 Identities = 6/18 (33%), Positives = 10/18 (55%) Frame = +1 Query: 217 WSPKRKWRLHPRSVSVGD 270 W P+R+W P + + D Sbjct: 119 WCPRREWSSPPDARAASD 136 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 20.6 bits (41), Expect = 8.9 Identities = 6/18 (33%), Positives = 10/18 (55%) Frame = +1 Query: 217 WSPKRKWRLHPRSVSVGD 270 W P+R+W P + + D Sbjct: 275 WCPRREWSSPPDARAASD 292 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,616 Number of Sequences: 336 Number of extensions: 2500 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12887571 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -