BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0678 (531 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC550.06c |hsp10||mitochondrial heat shock protein Hsp10|Schiz... 60 3e-10 SPAC9G1.10c |||inositol polyphosphate phosphatase |Schizosacchar... 27 1.3 SPAP27G11.04c |||tRNA specific adenosine deaminase subunit Tad3 ... 25 5.3 SPAC959.09c |apc5|SPAP32A8.01c|anaphase-promoting complex subuni... 25 7.0 SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyce... 25 7.0 SPAC20G8.05c |cdc15||cell division control protein Cdc15|Schizos... 25 7.0 >SPCC550.06c |hsp10||mitochondrial heat shock protein Hsp10|Schizosaccharomyces pombe|chr 3|||Manual Length = 104 Score = 59.7 bits (138), Expect = 3e-10 Identities = 26/54 (48%), Positives = 38/54 (70%) Frame = +2 Query: 77 AVKRLVPLLDRVLIKRAEAITKTAGGIVIPEKAQSKVLHGEVVAVGPGARKENG 238 + K +VPLLDR+L++R +A TKTA GI +PEK+ K+ G V++VG G + G Sbjct: 7 SAKSIVPLLDRILVQRIKADTKTASGIFLPEKSVEKLSEGRVISVGKGGYNKEG 60 Score = 44.8 bits (101), Expect = 8e-06 Identities = 21/48 (43%), Positives = 35/48 (72%) Frame = +1 Query: 229 RKWRLHPRSVSVGDKVLLPEYGGTKVSLENDEKEYHLFRESDILAKIE 372 ++ +L SV+VGD+VLLP YGG+ + + E+EY L+R+ ++LA I+ Sbjct: 58 KEGKLAQPSVAVGDRVLLPAYGGSNIKV--GEEEYSLYRDHELLAIIK 103 >SPAC9G1.10c |||inositol polyphosphate phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1191 Score = 27.5 bits (58), Expect = 1.3 Identities = 22/70 (31%), Positives = 36/70 (51%) Frame = +1 Query: 292 GGTKVSLENDEKEYHLFRESDILAKIEN*MMVALTCDSNSVSLVVACANETLIWSCIFCE 471 GG+ S N +Y L+RE K+E+ MM SN V+ C N ++SC+F + Sbjct: 857 GGSSNSA-NISSQYRLWRE-----KLESEMM---RVSSNDDYQVLVCENLVGLFSCVFVK 907 Query: 472 VLILSQLQYL 501 + S+++ L Sbjct: 908 NKLQSKIRML 917 >SPAP27G11.04c |||tRNA specific adenosine deaminase subunit Tad3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 315 Score = 25.4 bits (53), Expect = 5.3 Identities = 8/29 (27%), Positives = 18/29 (62%) Frame = -2 Query: 116 SGHGPEEEPIVLLHWPFRFLINRIQKRRI 30 S + P+E + L WPF+ + + ++ R++ Sbjct: 7 SKNSPKEATVPELDWPFKLIKSHLETRKL 35 >SPAC959.09c |apc5|SPAP32A8.01c|anaphase-promoting complex subunit Apc5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 737 Score = 25.0 bits (52), Expect = 7.0 Identities = 10/47 (21%), Positives = 26/47 (55%) Frame = -2 Query: 446 NVSFAHATTKLTELESHVKATIIQFSIFASMSDSLKR*YSFSSFSRL 306 N S T++ ++ SH+ ++I ++S+++ + + L +SF + Sbjct: 62 NDSQPQTLTRIHDITSHLPSSIEEYSVYSLLHERLWSLHSFEDIHEI 108 >SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1610 Score = 25.0 bits (52), Expect = 7.0 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 Query: 46 ILLIKNRNGQCSKTIGSSSGPC 111 +L +KNRN Q + S GPC Sbjct: 507 VLYLKNRNFQTGNEVMSILGPC 528 >SPAC20G8.05c |cdc15||cell division control protein Cdc15|Schizosaccharomyces pombe|chr 1|||Manual Length = 927 Score = 25.0 bits (52), Expect = 7.0 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -3 Query: 517 YYNRNASIATEIRSIPHK 464 Y++RN SIA++I +P K Sbjct: 630 YHSRNTSIASDIDGVPKK 647 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,037,966 Number of Sequences: 5004 Number of extensions: 39256 Number of successful extensions: 126 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 125 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 218398248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -