BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0678 (531 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 25 1.6 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 25 2.1 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 23 4.8 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 25.0 bits (52), Expect = 1.6 Identities = 14/47 (29%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 73 QCSKT-IGSSSGPCPDQKS*SYNQNCRRHCHPREGSIQGFTRRSSSG 210 +C K + S PCP + S C+ C P +GF R + G Sbjct: 25 RCPKNEVYSCCAPCPQKACISEAVKCQTSCLPGCVCKKGFVRETQFG 71 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 24.6 bits (51), Expect = 2.1 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 277 LLPEYGGTKVSLENDEKEYHLFRESD 354 LL E GT+V E E+ +L RES+ Sbjct: 158 LLREVAGTRVYDERKEESMNLLRESE 183 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 23.4 bits (48), Expect = 4.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 526 NNYYYNRNASIATEIRSI 473 N+YY + NAS+ EI I Sbjct: 1065 NDYYVSENASVGAEIAII 1082 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 506,611 Number of Sequences: 2352 Number of extensions: 9077 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49051644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -