BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0677 (743 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8683| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_31615| Best HMM Match : GCC2_GCC3 (HMM E-Value=0.053) 28 7.0 >SB_8683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -3 Query: 603 TIDSSKKYYSTFVRYCKQK**KSQKDVN 520 TID +KYY +R C K K +KDV+ Sbjct: 134 TIDKIQKYYGNAIRACINKKAKKEKDVD 161 >SB_31615| Best HMM Match : GCC2_GCC3 (HMM E-Value=0.053) Length = 870 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -2 Query: 121 CAYIRKASMSVEVFNIKYTTFFLNNFLVFIVI 26 C++ KA SV+ F KY TF +LV+I++ Sbjct: 417 CSFFLKADYSVQCFTEKYNTFM---YLVYILL 445 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,143,070 Number of Sequences: 59808 Number of extensions: 312528 Number of successful extensions: 420 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 420 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2010148439 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -