BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0677 (743 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U64604-1|AAF98623.1| 243|Caenorhabditis elegans Hypothetical pr... 29 4.6 Z92829-14|CAB07342.2| 337|Caenorhabditis elegans Hypothetical p... 28 8.0 >U64604-1|AAF98623.1| 243|Caenorhabditis elegans Hypothetical protein F49E7.2 protein. Length = 243 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/49 (24%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = +1 Query: 445 MLPKIDRCIIICNEYYS*IKINEYGIYVFLRFSLFLFTISH--EC*IIF 585 ++ + CI++ + + +K+N YG++ L+ F+ T S +C I++ Sbjct: 40 LIVNVQSCILLAKDNHGDMKVNGYGLHRELKLPAFIQTQSRIPQCRILY 88 >Z92829-14|CAB07342.2| 337|Caenorhabditis elegans Hypothetical protein F10A3.8 protein. Length = 337 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -2 Query: 145 YKTTCALYCA-YIRKASMSVEVFNIKYTTFFLNNFLVFIVI*ICSCY 8 Y + C +C Y+ + S +FN+ T N V + CSCY Sbjct: 56 YFSCCDFWCKPYVHMSKNSFAIFNVLEETKLTQNTGVIALELYCSCY 102 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,456,360 Number of Sequences: 27780 Number of extensions: 269064 Number of successful extensions: 474 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 474 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1756472266 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -