BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0675 (609 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF038611-9|AAB92041.2| 180|Caenorhabditis elegans Ribosomal pro... 118 3e-27 >AF038611-9|AAB92041.2| 180|Caenorhabditis elegans Ribosomal protein, large subunitprotein 20 protein. Length = 180 Score = 118 bits (284), Expect = 3e-27 Identities = 53/86 (61%), Positives = 65/86 (75%) Frame = +3 Query: 255 YESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAHSIQIIKVEVIKAAACRRPQVK 434 Y+SR+G HNMYREYRD +V GAVTQCYRDMGARHRA+A I I+KV+ +KA +R +K Sbjct: 87 YDSRTGHHNMYREYRDTTVAGAVTQCYRDMGARHRAQADRIHILKVQTVKAEDTKRAGIK 146 Query: 435 QFHNSTIRFPLPKRVHHYKRLNTFAT 512 FH++ IRFPLP RV K L+ F T Sbjct: 147 MFHDAKIRFPLPHRVTKRKNLSVFTT 172 Score = 86.2 bits (204), Expect = 2e-17 Identities = 37/83 (44%), Positives = 55/83 (66%), Gaps = 1/83 (1%) Frame = +1 Query: 10 KAKGQ-LREYEVIGRKLPSENEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGE 186 KA G+ L EY V+GRK+P+E EP P++KM+IF+ + ++AKSRFWYF+ L++ KK GE Sbjct: 4 KALGETLNEYVVVGRKIPTEKEPVTPIWKMQIFATNHVIAKSRFWYFVSMLRRVKKANGE 63 Query: 187 IVXXXXXXXXXXXXXXNFGIWLR 255 I+ N+G+WL+ Sbjct: 64 ILSIKQVFEKNPGTVKNYGVWLK 86 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,647,015 Number of Sequences: 27780 Number of extensions: 315370 Number of successful extensions: 882 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 836 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 881 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1311096392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -