BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0674 (777 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 27 0.17 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 26 0.29 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 23 2.7 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 23 2.7 AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 23 3.6 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 27.1 bits (57), Expect = 0.17 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = -2 Query: 626 IKNLISIFISTRNRVNP*LFHEEYLVVHLHLC*TSSNWPLCFIH 495 I +L+S + R+RVNP LF+ + V LH T + FIH Sbjct: 104 IDDLLSNAVFCRDRVNPYLFYYAFSVALLHRPDTQNLDLPSFIH 147 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 26.2 bits (55), Expect = 0.29 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +1 Query: 277 SMQIYHKVYFPDDTDEAFEVDSSTKARDLCEQITGRLNLKNSDGFSLFVKIADKV 441 ++QI + PD+T VD STK R E +T + N K++ KV Sbjct: 437 NVQIENLKTTPDNTTFITLVDVSTKRRTELEDLTPTFDFTNGWANGTLAKLSPKV 491 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 23.0 bits (47), Expect = 2.7 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = +2 Query: 53 NNRIQLSEERGWELLW 100 N ++L +E GW+++W Sbjct: 300 NEIVELQKEGGWKVVW 315 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 23.0 bits (47), Expect = 2.7 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +2 Query: 59 RIQLSEERGWELLWLATGVFACSQVLMKELVEFLKTRPHPI 181 +++ EE+ +++W G F SQV + + F R H + Sbjct: 273 QVRFFEEKNGKVVWEGFGDFQPSQVHKQTAICFKAPRYHTL 313 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -3 Query: 76 FTQLYSIVGQLLHYVTVY 23 +T LYSIVG + Y+ ++ Sbjct: 364 YTLLYSIVGAVTTYLVIF 381 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,288 Number of Sequences: 336 Number of extensions: 3799 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20961338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -