BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0673 (646 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 25 0.53 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 2.2 AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical pro... 22 3.8 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 25.0 bits (52), Expect = 0.53 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = +2 Query: 35 FFTPSNSRQA---KDLVSVLQEANQIISPQL 118 FF+P R K LV V + NQ+ +PQL Sbjct: 73 FFSPKIKRMVLLHKTLVRVAKSLNQVFAPQL 103 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 23.0 bits (47), Expect = 2.2 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 Query: 236 YSCQNCFRV*KSRHHLVH 183 + C C + RHHLVH Sbjct: 247 FECDKCRGRFRRRHHLVH 264 >AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical protein protein. Length = 86 Score = 22.2 bits (45), Expect = 3.8 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 Query: 326 YITRIHPLRNANKNLI 279 Y+ HPL +NKN I Sbjct: 45 YVKHFHPLALSNKNAI 60 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,242 Number of Sequences: 336 Number of extensions: 2858 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16552695 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -