BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0672 (525 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0253 - 16196275-16196307,16196425-16196550,16196643-161967... 30 0.99 02_03_0303 - 17506392-17506399,17507055-17507286,17507390-175074... 28 4.0 01_01_1023 - 8070122-8070808 28 4.0 12_02_0131 - 14030721-14030774,14030848-14031027,14032050-140323... 27 7.0 >10_08_0253 - 16196275-16196307,16196425-16196550,16196643-16196741, 16196822-16197001,16197090-16197371,16197471-16199141, 16199257-16199463,16199566-16199700,16199792-16200082, 16200403-16200621,16200876-16201034,16201120-16201181, 16201257-16201383,16201460-16201693,16201777-16202003, 16202163-16202257,16202341-16202468,16202574-16202594, 16202765-16202921,16203007-16203075,16203228-16203341, 16203415-16203491,16203576-16203688,16204432-16204507, 16204592-16204756,16204825-16204952,16205049-16205130, 16205426-16205548,16205633-16205860,16205933-16206034, 16206144-16206341,16206581-16206760,16206868-16207020, 16207690-16207797,16208201-16208355,16208786-16208912, 16209825-16209914,16209986-16210127,16210303-16210379, 16210467-16210582,16210638-16210773,16211130-16211198, 16211279-16211361,16211655-16211720,16211788-16211974, 16212054-16213547,16213635-16214165,16214234-16214363, 16214407-16215878,16216359-16216364,16216750-16217055, 16217364-16217468,16217577-16217772,16217862-16217929, 16218853-16220631,16221026-16221151,16221604-16221780, 16221997-16222128,16223461-16223498,16223710-16223788, 16224175-16224284,16224787-16224935,16225027-16225197, 16225281-16225552,16226355-16226442,16227942-16228369 Length = 5157 Score = 30.3 bits (65), Expect = 0.99 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = -2 Query: 410 INLDFVWLN-CTHELRPKCYCYFLYIVFLTSPNFHPVVQSPAGCVRNV 270 + L +W N C H L+P C + Y L + HP+ S C R + Sbjct: 2427 LKLYAIWFNWCNHLLQPYCNFFENYGNILKKESDHPIWHSILECYREI 2474 >02_03_0303 - 17506392-17506399,17507055-17507286,17507390-17507461, 17507561-17508586,17509194-17509448,17510483-17510962 Length = 690 Score = 28.3 bits (60), Expect = 4.0 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +1 Query: 1 VAAVSAVEKEDFDSFRRSTLNLGVIGNQDRLLRSEN 108 VA++ ++ E FD FR+S L++GV+ LL EN Sbjct: 409 VASIVSILSE-FDMFRKSVLDIGVVTLLCNLLNFEN 443 >01_01_1023 - 8070122-8070808 Length = 228 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/39 (35%), Positives = 25/39 (64%) Frame = -2 Query: 263 GKGEPSPP*VSLIEPDCDAPTSLARMALMRVPVGANKVN 147 G+G P PP V++I +C P+++ R ++ VP G + V+ Sbjct: 33 GRGAPKPPPVAVIAHEC--PSAM-RALVVEVPAGRDVVS 68 >12_02_0131 - 14030721-14030774,14030848-14031027,14032050-14032303, 14034414-14034488,14034682-14034910 Length = 263 Score = 27.5 bits (58), Expect = 7.0 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -2 Query: 308 PVVQSPAGCVRNVKSGKGEPS 246 PV P GC K+GKG PS Sbjct: 76 PVKALPRGCGNRAKNGKGNPS 96 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,131,106 Number of Sequences: 37544 Number of extensions: 263723 Number of successful extensions: 470 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 470 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1154538620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -