BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0671 (689 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 27 0.17 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 25 0.68 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 1.2 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 24 1.6 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 23 2.7 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 4.8 EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholi... 21 8.4 EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholi... 21 8.4 EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholi... 21 8.4 EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 21 8.4 EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholi... 21 8.4 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 21 8.4 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 21 8.4 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 21 8.4 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 21 8.4 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 21 8.4 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 27.1 bits (57), Expect = 0.17 Identities = 14/54 (25%), Positives = 28/54 (51%) Frame = -1 Query: 491 SNGSNVSNLDRLGDGAIDNNHGFSNDFGFVNDNHGLRDNGIDTGSGDNRGRASL 330 SN S ++ + + + +NN+ +N+ N+N+G DNG G+ +N + Sbjct: 223 SNNSTITAGNANTNASNNNNNNNNNN----NNNNGANDNGNGNGASNNNNNGDM 272 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 25.0 bits (52), Expect = 0.68 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = -1 Query: 482 SNVSNLDRLGDGAIDNNHGFSNDFGF---VNDNHGLRDNGIDTGSGDN 348 S++ D+L D I S D VN +HG++ +G + GD+ Sbjct: 664 SSIKASDKLKDSRIKTTEKLSTDPNTHFQVNQSHGIKRSGSHSWEGDS 711 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.2 bits (50), Expect = 1.2 Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Frame = -1 Query: 278 KRRVVYDSGPTEIGTNSSTMAGPTEIGSNSLTMAGPTEMGSNSSMMA-GPTAIGTKSSMM 102 +RR+ D E+G + G S AG T+ + +++ G T +S Sbjct: 179 ERRLRPDEIKVEVGEDEFANGGAARDESK----AGSTDASTPATVTTTGATTTLPAASAT 234 Query: 101 GAGPATP 81 G GPATP Sbjct: 235 GTGPATP 241 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 23.8 bits (49), Expect = 1.6 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 132 RTCHHR*VRAHFRRTCHCQR 191 R HH AH RRT H R Sbjct: 149 RCLHHDIENAHIRRTLHMNR 168 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 23.0 bits (47), Expect = 2.7 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -1 Query: 455 GDGAIDNNHGFSNDFGFVNDNHGLRDNGIDTGSGDNR 345 G G GF+N +DN+ DN D G+ DNR Sbjct: 93 GRGGNRGRTGFNNKNKDGDDNNDYEDN--DYGNQDNR 127 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 116 KSSMMGAGPATPGFTRP 66 K S G PA+PG+ +P Sbjct: 103 KMSTRGKRPASPGYVQP 119 >EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 6 protein. Length = 461 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -3 Query: 249 NGDRYELVDDGRPNGDRFEFVDNG 178 +G++ +LV GD +F+ NG Sbjct: 135 DGNQVDLVLSSETGGDLSDFITNG 158 >EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 5 protein. Length = 461 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -3 Query: 249 NGDRYELVDDGRPNGDRFEFVDNG 178 +G++ +LV GD +F+ NG Sbjct: 135 DGNQVDLVLSSETGGDLSDFITNG 158 >EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 4 protein. Length = 461 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -3 Query: 249 NGDRYELVDDGRPNGDRFEFVDNG 178 +G++ +LV GD +F+ NG Sbjct: 135 DGNQVDLVLSSETGGDLSDFITNG 158 >EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 461 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -3 Query: 249 NGDRYELVDDGRPNGDRFEFVDNG 178 +G++ +LV GD +F+ NG Sbjct: 135 DGNQVDLVLSSETGGDLSDFITNG 158 >EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 2 protein. Length = 461 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -3 Query: 249 NGDRYELVDDGRPNGDRFEFVDNG 178 +G++ +LV GD +F+ NG Sbjct: 135 DGNQVDLVLSSETGGDLSDFITNG 158 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -3 Query: 249 NGDRYELVDDGRPNGDRFEFVDNG 178 +G++ +LV GD +F+ NG Sbjct: 135 DGNQVDLVLSSETGGDLSDFITNG 158 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 8.4 Identities = 5/21 (23%), Positives = 15/21 (71%) Frame = -1 Query: 452 DGAIDNNHGFSNDFGFVNDNH 390 + ++ NN+ ++N++ N+N+ Sbjct: 85 NNSLSNNYNYNNNYNNYNNNY 105 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -3 Query: 249 NGDRYELVDDGRPNGDRFEFVDNG 178 +G++ +LV GD +F+ NG Sbjct: 203 DGNQVDLVLSSETGGDLSDFITNG 226 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -3 Query: 249 NGDRYELVDDGRPNGDRFEFVDNG 178 +G++ +LV GD +F+ NG Sbjct: 203 DGNQVDLVLSSETGGDLSDFITNG 226 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.4 bits (43), Expect = 8.4 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 152 SSMMAGPTAIGTKSSMM 102 +S +AG AIGT + MM Sbjct: 275 NSTLAGGVAIGTAAGMM 291 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,008 Number of Sequences: 438 Number of extensions: 3253 Number of successful extensions: 19 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -