BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0669 (766 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1753.03c |rec7||meiotic recombination protein Rec7 |Schizosa... 28 1.7 SPAC17C9.05c |pmc3|prk1, med27|mediator complex subunit Pmc3 |Sc... 27 3.9 SPAC23C11.04c |pnk1||DNA kinase/phosphatase Pnk1|Schizosaccharom... 26 6.8 SPAC17G6.13 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 25 9.0 SPAC11H11.04 |mam2||pheromone p-factor receptor|Schizosaccharomy... 25 9.0 >SPCC1753.03c |rec7||meiotic recombination protein Rec7 |Schizosaccharomyces pombe|chr 3|||Manual Length = 339 Score = 27.9 bits (59), Expect = 1.7 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = -1 Query: 202 DDRATASKHSAGWIHHAEGGVVGVLTGSRLPTRYNTEICGIYIFVDIFNEV 50 D T S H W H+++GG LT L R + E+ +D+++++ Sbjct: 14 DSYTTDSSH-INWSHYSDGGFTLSLTSGLLQIRQHEELIQSINLLDLWHQL 63 >SPAC17C9.05c |pmc3|prk1, med27|mediator complex subunit Pmc3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 273 Score = 26.6 bits (56), Expect = 3.9 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 50 YFIEDINKDVDTTNLRIVSGWEATPGQHPHHAAL 151 Y ED++ D + + ++G A + PHH+ L Sbjct: 95 YNSEDLSNDTENNETKSINGKSALDLKEPHHSEL 128 >SPAC23C11.04c |pnk1||DNA kinase/phosphatase Pnk1|Schizosaccharomyces pombe|chr 1|||Manual Length = 421 Score = 25.8 bits (54), Expect = 6.8 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +2 Query: 53 FIEDINKDVDTTNLRIVSGWEATPGQH 133 F++D+N+ +D + ++ V PG H Sbjct: 172 FLKDVNRSIDLSFIKYVGDAAGRPGDH 198 >SPAC17G6.13 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 433 Score = 25.4 bits (53), Expect = 9.0 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +1 Query: 337 DDTRPNLVQPNDISLLRLHRPVVFTRYLQPIRVQSSAD 450 D LV PN+ + +H PVV T Y +S A+ Sbjct: 132 DSPNMQLVVPNNFQQMFIHHPVVDTIYSPEESSESQAE 169 >SPAC11H11.04 |mam2||pheromone p-factor receptor|Schizosaccharomyces pombe|chr 1|||Manual Length = 348 Score = 25.4 bits (53), Expect = 9.0 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +3 Query: 426 NSCAIVG*CLQELRRTHRVCQRSWSSLENGATPEVLNWVYL 548 NS +IV CL+ + +C S+S L N +LN V++ Sbjct: 83 NSASIVAMCLRAILNIVTICSNSYSILVNYGF--ILNMVHM 121 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,519,953 Number of Sequences: 5004 Number of extensions: 77223 Number of successful extensions: 188 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 186 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 188 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 367316502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -