BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0664 (549 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 25 0.51 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 2.7 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 22 4.7 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 6.2 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 6.2 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 25.0 bits (52), Expect = 0.51 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -2 Query: 170 NTLFLFNHVFEVTNSTTERHLSDCHCGLICVLKV 69 N FL + +F+ LSD GL C + V Sbjct: 312 NARFLMDSMFDFAERVNSLRLSDAELGLFCSVVV 345 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.6 bits (46), Expect = 2.7 Identities = 17/58 (29%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = +2 Query: 182 LQRRRWSLCSSKAVWHNTGSLAQETAEFLLQLLRNAESNADNK-TLDVDRLVIDHIQV 352 L RR S S + S A E EF+ + LRN + + +VID +Q+ Sbjct: 426 LADRRGSESSDSVLLSPEASKATEAVEFIAEHLRNEDLYIQTREDWKYVAMVIDRLQL 483 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +1 Query: 55 QTSVFTLRTHMRPQWQSE 108 QT VF L TH W S+ Sbjct: 171 QTIVFHLETHPNVTWYSQ 188 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 72 SEHGGLNHALCMISQGYP 19 +E GLNH M++ YP Sbjct: 223 TEDVGLNHFYFMLNHNYP 240 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 72 SEHGGLNHALCMISQGYP 19 +E GLNH M++ YP Sbjct: 223 TEDVGLNHFYFMLNHNYP 240 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,228 Number of Sequences: 438 Number of extensions: 3122 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -