BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0663 (748 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subu... 24 1.1 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 21 7.9 >S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subunit protein. Length = 141 Score = 24.2 bits (50), Expect = 1.1 Identities = 11/44 (25%), Positives = 21/44 (47%) Frame = -2 Query: 393 QYNILTHTQHIMCFVIT*FKFIHRGDVVSFIKTIHLILITNYVP 262 Q+ +L H Q M +T + + F++++ LI Y+P Sbjct: 34 QFKVLGHRQRAMEISLTTGNYSRLACEIQFVRSMGYYLIQIYIP 77 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 540 FFR*LYFVIIIFLMF 584 F+ LYF+ IIFL F Sbjct: 232 FWSALYFLTIIFLFF 246 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,857 Number of Sequences: 336 Number of extensions: 3391 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19923648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -