BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0663 (748 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35254| Best HMM Match : Vicilin_N (HMM E-Value=0.066) 29 5.3 SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) 28 9.2 >SB_35254| Best HMM Match : Vicilin_N (HMM E-Value=0.066) Length = 909 Score = 28.7 bits (61), Expect = 5.3 Identities = 19/49 (38%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = -1 Query: 493 STTFRISSRNYLNKDEYKMFNINKKT--LNITDMHTIQHSHTYSTHNVF 353 STT R+ S++ LNK YK +N T L DM + H NVF Sbjct: 113 STTMRLISQHALNKVTYKASLLNDFTVELGFYDMPPEERKHRKIETNVF 161 >SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) Length = 453 Score = 27.9 bits (59), Expect = 9.2 Identities = 10/48 (20%), Positives = 23/48 (47%) Frame = +3 Query: 102 YSKLNNSHRPYTEYTKIFMVF*KYFFKLTINIILVLEYYLVLKSAHHR 245 + + N HR +T+ + +F + INI +++ ++ HH+ Sbjct: 344 HHEYNRRHRYFTDINITIQIIRHHFIIIIINITIIIMMITIMTFKHHK 391 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,069,033 Number of Sequences: 59808 Number of extensions: 348837 Number of successful extensions: 512 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 476 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 512 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -