BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0660 (707 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g47880.1 68418.m05915 eukaryotic peptide chain release factor... 32 0.43 At3g18680.2 68416.m02373 aspartate/glutamate/uridylate kinase fa... 30 1.3 At2g30920.1 68415.m03769 hexaprenyldihydroxybenzoate methyltrans... 29 4.0 At3g26990.1 68416.m03377 expressed protein contains Pfam domain,... 28 5.3 At3g26618.1 68416.m03325 eukaryotic release factor 1 family prot... 28 5.3 At1g12920.1 68414.m01500 eukaryotic release factor 1 family prot... 28 5.3 At5g59020.1 68418.m07393 expressed protein 28 7.0 At2g35090.1 68415.m04305 hypothetical protein 28 7.0 At1g67120.1 68414.m07636 midasin-related similar to Midasin (MID... 28 7.0 At1g54970.1 68414.m06278 proline-rich family protein similar to ... 28 7.0 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 27 9.2 At1g14070.1 68414.m01664 xyloglucan fucosyltransferase, putative... 27 9.2 >At5g47880.1 68418.m05915 eukaryotic peptide chain release factor subunit 1-1 (ERF1-1) identical to SP|Q39097 Eukaryotic peptide chain release factor subunit 1-1 (eRF1-1) (Eukaryotic release factor 1-1) (Omnipotent suppressor protein 1 homolog 1) (SUP1 homolog 1) {Arabidopsis thaliana}, eukaryotic release factor 1 homolog GI:1155261 from [Arabidopsis thaliana]; contains Pfam profiles: PF03463 eRF1 domain 1, PF03464 eRF1 domain 2, PF03465 eRF1 domain 3 Length = 436 Score = 31.9 bits (69), Expect = 0.43 Identities = 28/99 (28%), Positives = 44/99 (44%) Frame = +2 Query: 50 SLSTQANNVMNAVITNTQGLLEDYYQSTSQSEDTCFYVPTLNPTSPPVFRGQCETITGVQ 229 ++ A + N + L+ Y++ SQ DT YV + T + G ET+ + Sbjct: 268 AIELSAEILANVKFIQEKRLIGKYFEEISQ--DTGKYVFGVEDTLNALESGAIETLIVWE 325 Query: 230 NFDVQRYLVGGMKLSGTQLRVTQGSVSAHSTQHQETNTK 346 N D+ RY+ MK S T +V H + QE NT+ Sbjct: 326 NLDINRYV---MKNS-----ATGETVIKHLNKEQEANTE 356 >At3g18680.2 68416.m02373 aspartate/glutamate/uridylate kinase family protein similar to UMP-kinase GB:CAB38122 gi:4468612 from [Lactococcus lactis] ; contains Pfam profile PF00696: Amino acid kinase family Length = 366 Score = 30.3 bits (65), Expect = 1.3 Identities = 18/50 (36%), Positives = 25/50 (50%) Frame = +2 Query: 11 NRRVGSWKLSRTTSLSTQANNVMNAVITNTQGLLEDYYQSTSQSEDTCFY 160 N+R SW + R NN+M I TQ LLE Y + +S ++C Y Sbjct: 319 NQRRESWYIDRRNLELHCYNNLMKKPILKTQNLLE--YLRSGESCNSCIY 366 >At2g30920.1 68415.m03769 hexaprenyldihydroxybenzoate methyltransferase identical to hexaprenyldihydroxybenzoate methyltransferase SP:O49354 from [Arabidopsis thaliana] Length = 322 Score = 28.7 bits (61), Expect = 4.0 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +2 Query: 542 REHSKARQLTAAAQNAMTPIITANRVLHQELYLTVD 649 R + R L +A + + +PII +R+LHQ L+ T D Sbjct: 6 RVNQLQRLLLSARRLSSSPIIPPSRLLHQRLFSTSD 41 >At3g26990.1 68416.m03377 expressed protein contains Pfam domain, PF04818: Protein of unknown function, DUF618 Length = 513 Score = 28.3 bits (60), Expect = 5.3 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 85 GHNEHPGSTGRLLSIYQPKRRHLLLCTHTQSYLTP 189 G+N P T L S+ P + L H QSYL+P Sbjct: 372 GNNNPPAVTETLSSVDFPPEKRPKLQNHDQSYLSP 406 >At3g26618.1 68416.m03325 eukaryotic release factor 1 family protein / eRF1 family protein contains Pfam profiles: PF03463 eRF1 domain 1, PF03464 eRF1 domain 2, PF03465 eRF1 domain 3 Length = 435 Score = 28.3 bits (60), Expect = 5.3 Identities = 18/67 (26%), Positives = 30/67 (44%) Frame = +2 Query: 50 SLSTQANNVMNAVITNTQGLLEDYYQSTSQSEDTCFYVPTLNPTSPPVFRGQCETITGVQ 229 ++ A + N + L+ Y++ SQ DT YV + T + G ET+ + Sbjct: 267 AIELSAEILSNVKFIQEKKLIGKYFEEISQ--DTGKYVFGVEDTLKALEMGAVETLIVWE 324 Query: 230 NFDVQRY 250 N D+ RY Sbjct: 325 NLDINRY 331 >At1g12920.1 68414.m01500 eukaryotic release factor 1 family protein / eRF1 family protein contains Pfam profiles: PF03463 eRF1 domain 1, PF03464 eRF1 domain 2, PF03465 eRF1 domain 3 Length = 434 Score = 28.3 bits (60), Expect = 5.3 Identities = 18/67 (26%), Positives = 30/67 (44%) Frame = +2 Query: 50 SLSTQANNVMNAVITNTQGLLEDYYQSTSQSEDTCFYVPTLNPTSPPVFRGQCETITGVQ 229 ++ A + N + L+ Y++ SQ DT YV + T + G ET+ + Sbjct: 266 AIELSAEILSNVKFIQEKKLIGKYFEEISQ--DTGKYVFGVEDTLKALEMGAIETLIVWE 323 Query: 230 NFDVQRY 250 N D+ RY Sbjct: 324 NLDINRY 330 >At5g59020.1 68418.m07393 expressed protein Length = 780 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 61 SSKQRHERGHNEHPGSTGR 117 S K HER NEH G GR Sbjct: 195 SEKNLHERNRNEHDGELGR 213 >At2g35090.1 68415.m04305 hypothetical protein Length = 124 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +2 Query: 56 STQANNVMNAVITNTQGLLEDYYQSTSQSED 148 STQA + A+ + + ++E YQSTS +E+ Sbjct: 44 STQAEALTGAITSGLESVVEKEYQSTSVAEE 74 >At1g67120.1 68414.m07636 midasin-related similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q12019) [Saccharomyces cerevisiae]; similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q9NU22) [Homo sapiens]; contains Prosite PS00017: ATP/GTP-binding site motif A (P-loop) Length = 5336 Score = 27.9 bits (59), Expect = 7.0 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = +1 Query: 49 VVEHSSKQRHERGHNEHPGSTGRLLSIYQPKR--RHLLLCTHTQSYLTP 189 ++E S Q+H+ + E LL YQP +HLLL THT+S + P Sbjct: 4019 LLESSGLQKHKFENIEMSNHFKGLL--YQPAYDPKHLLLLTHTKSNIHP 4065 >At1g54970.1 68414.m06278 proline-rich family protein similar to proline-rich protein GI:170048 from [Glycine max] Length = 335 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +3 Query: 99 PRVYWKTTINLPAKAKTPAFMYPHSILPHPLY 194 P VY K T+ P K+P++ P P P Y Sbjct: 168 PPVYTKPTLPPPVYKKSPSYSPPPPFAPKPTY 199 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 27.5 bits (58), Expect = 9.2 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 Query: 143 EDTCFYVPTLNPTSPP 190 ED+ +Y PTLNPT P Sbjct: 123 EDSVYYHPTLNPTGAP 138 >At1g14070.1 68414.m01664 xyloglucan fucosyltransferase, putative (FUT7) nearly identical to SP|Q9XI81 Probable fucosyltransferase 7 (EC 2.4.1.-) (AtFUT7) {Arabidopsis thaliana}; similar to xyloglucan fucosyltransferase GI:5231145 from (Arabidopsis thaliana) Length = 509 Score = 27.5 bits (58), Expect = 9.2 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +1 Query: 94 EHPGSTGRLLSIYQPKR 144 EHP +TG ++ +YQP R Sbjct: 375 EHPTTTGDIVEVYQPSR 391 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,710,360 Number of Sequences: 28952 Number of extensions: 327052 Number of successful extensions: 954 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 921 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 954 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1526202912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -