BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0654 (697 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 26 0.34 AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like pr... 22 5.5 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 5.5 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 5.5 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 7.3 AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory recept... 21 7.3 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 25.8 bits (54), Expect = 0.34 Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = -1 Query: 349 IQQLIDRIDERWPDP-RCIISIQD-SSRRRLRLHFSGEVSGYDESVEVSSDSFT 194 +QQL+D I+ + DP +C+I + S + L++H+ ++ +FT Sbjct: 120 LQQLVDNIEHKLSDPNQCVICHRVLSCKSALQMHYRTHTGERPFKCKICGRAFT 173 >AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like protein protein. Length = 242 Score = 21.8 bits (44), Expect = 5.5 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +3 Query: 564 TAGLIGYDYPLGDLDFYPSGGSGQSGCLDDACSHSYA 674 + G+ G YP D + YPS G +S S+ YA Sbjct: 6 SVGVYGAPYPSTDQNPYPSIGV-ESSAFYSPLSNPYA 41 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 5.5 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 77 HLFHRGSPQVSEPLLLS 127 H F GSP+ +EPL S Sbjct: 5 HRFATGSPEETEPLYSS 21 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 5.5 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 77 HLFHRGSPQVSEPLLLS 127 H F GSP+ +EPL S Sbjct: 5 HRFATGSPEETEPLYSS 21 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +3 Query: 522 LNPDDANIVEVL 557 LNPD+ N+ E+L Sbjct: 369 LNPDNPNVYEIL 380 >AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory receptor candidate 22 protein. Length = 301 Score = 21.4 bits (43), Expect = 7.3 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -2 Query: 405 DNANKLGIVAEGCSQDIDEFSN*STALTSV 316 + ANK I+ G DID+ + +TSV Sbjct: 218 NEANKTKILLVGLKIDIDQEEERNVVVTSV 247 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,970 Number of Sequences: 336 Number of extensions: 3419 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -