BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0647 (380 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 2.1 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 2.1 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 22 2.8 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 2.8 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 3.7 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 3.7 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 6.5 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 20 8.5 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 20 8.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 20 8.5 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 20 8.5 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.2 bits (45), Expect = 2.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 209 FHLALSTRPLGWAMLTSP 156 FHL ++T P G A + SP Sbjct: 363 FHLYINTAPCGDARIFSP 380 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.2 bits (45), Expect = 2.1 Identities = 8/35 (22%), Positives = 19/35 (54%) Frame = +1 Query: 187 LVESAKWKAWNGRKGISQDDAKNNTSKMRRNSTPN 291 L + + K W+G + +++ +N ++R TP+ Sbjct: 253 LSDEDQTKGWDGSNMVEGNESDHNDGRLRYWRTPS 287 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.8 bits (44), Expect = 2.8 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +1 Query: 217 NGRKGISQDDAKNNTSKMRRNSTPNTH 297 N R G Q+D +NN + RN H Sbjct: 513 NKRNGNRQNDNQNNQNDNNRNDNQVHH 539 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.8 bits (44), Expect = 2.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 47 LSTSNSNRSPIRLGTGRPSPVTMRTL 124 LST+ ++ P G + SPV+M L Sbjct: 372 LSTALMSQPPPNFGVSQVSPVSMSAL 397 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 3.7 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -1 Query: 221 PFHAFHLALSTRPLGWAMLTSPMV 150 PF + H L+ RPL T PM+ Sbjct: 1040 PFVSNHDILNLRPLSMEKGTRPMI 1063 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 3.7 Identities = 8/26 (30%), Positives = 17/26 (65%) Frame = +3 Query: 201 QVEGMERSQRHLPRRCQEQYIENAEK 278 Q + M+ Q+H ++ Q Q++ NA++ Sbjct: 414 QQQQMQAQQQHQQQQQQTQHVINAQQ 439 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 20.6 bits (41), Expect = 6.5 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +1 Query: 103 PSDDENLALYSLYKQATIGDVNIAQPSGLVE 195 P+D+ + Y+++ + GD + AQ S V+ Sbjct: 1390 PTDNAPIHGYTIHYKPEFGDWDTAQISSTVQ 1420 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 20.2 bits (40), Expect = 8.5 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -1 Query: 137 REYSARFSSSL 105 R YS RFSSS+ Sbjct: 22 RRYSKRFSSSI 32 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 20.2 bits (40), Expect = 8.5 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +2 Query: 173 PSPAVLWRAPSGRHGTVAKASPKT 244 P+P W A +G + + P+T Sbjct: 265 PTPEYRWYAQTGSEPMLVLSGPRT 288 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 20.2 bits (40), Expect = 8.5 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +2 Query: 173 PSPAVLWRAPSGRHGTVAKASPKT 244 P+P W A +G + + P+T Sbjct: 265 PTPEYRWYAQTGSEPMLVLSGPRT 288 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 20.2 bits (40), Expect = 8.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +1 Query: 13 LPPDLKR*HKMSLDEQFKQVADKVRN 90 L ++KR ++ KQVAD++RN Sbjct: 384 LDEEMKRTDELLYQMIPKQVADRLRN 409 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,532 Number of Sequences: 438 Number of extensions: 3031 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9300375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -