BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0646 (480 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g14390.1 68417.m02219 ankyrin repeat family protein contains ... 29 1.2 At4g15050.1 68417.m02311 expressed protein contains Pfam profil... 27 5.0 At4g33590.1 68417.m04772 hypothetical protein 27 6.5 >At4g14390.1 68417.m02219 ankyrin repeat family protein contains Pfam profile: PF00023 ankyrin repeat Length = 694 Score = 29.5 bits (63), Expect = 1.2 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = -3 Query: 196 FTIYPGSDSTVNPSLGQVTLFDLP*LFIYLIMVVM 92 FTI PG ++ P LG+ TL P LFI+L++ ++ Sbjct: 538 FTI-PGGFNSSAPHLGRATLATNPTLFIFLVLDIL 571 >At4g15050.1 68417.m02311 expressed protein contains Pfam profile PF03080: Arabidopsis proteins of unknown function Length = 396 Score = 27.5 bits (58), Expect = 5.0 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Frame = -2 Query: 437 QIGRNIFKYNNFINQTIYRQYD---FIVLYNSERSCLSMYC 324 QIG + + +N T+Y+ F+ + E+SC + YC Sbjct: 198 QIGNDFLQTGFTVNPTLYKDSQPRTFVYTKSGEKSCYNSYC 238 >At4g33590.1 68417.m04772 hypothetical protein Length = 466 Score = 27.1 bits (57), Expect = 6.5 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -3 Query: 427 EIYLNTIILLIRLFIDNMILLFSITQSVPVSPCIVIQYFK 308 + YLN + L++ +F+ I F ITQ P ++ Y K Sbjct: 19 KFYLNVLCLVVTVFVLLQICSFQITQRSLSLPPALLTYLK 58 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,730,195 Number of Sequences: 28952 Number of extensions: 158898 Number of successful extensions: 295 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 293 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 295 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 819227264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -