BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0639 (630 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35518| Best HMM Match : Peptidase_A17 (HMM E-Value=1.3e-09) 29 2.4 SB_42206| Best HMM Match : Clat_adaptor_s (HMM E-Value=3.5) 29 3.1 >SB_35518| Best HMM Match : Peptidase_A17 (HMM E-Value=1.3e-09) Length = 385 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/40 (32%), Positives = 25/40 (62%) Frame = -1 Query: 441 KWEINTTILKIMFTIIRYLVPYEYAN*LFNEMIHFNDLSA 322 KW +N +L+ F++ RYL P ++ + E+ +F+D S+ Sbjct: 289 KWRLNLQLLE-KFSMDRYLKPQDFGPVMVREIHNFSDASS 327 >SB_42206| Best HMM Match : Clat_adaptor_s (HMM E-Value=3.5) Length = 167 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +2 Query: 35 YTNQYKIHLTTCQIKSITLEGEILTDKIIILLN 133 + N+ + H+ TC K TLE E+L D+I+ +N Sbjct: 112 FVNRLRDHIATC--KYTTLENEMLRDRIVFGVN 142 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,707,547 Number of Sequences: 59808 Number of extensions: 311481 Number of successful extensions: 570 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 569 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1572561250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -