BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0639 (630 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83230-1|CAB05741.1| 1049|Caenorhabditis elegans Hypothetical pr... 28 6.3 Z81030-2|CAB02704.2| 343|Caenorhabditis elegans Hypothetical pr... 28 6.3 >Z83230-1|CAB05741.1| 1049|Caenorhabditis elegans Hypothetical protein F56A8.1 protein. Length = 1049 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +1 Query: 235 ANIKTKYNIWRNHSSVPGANNSILT*KYFGAKIIKMY 345 +N+ ++ N W NH + NNS++ K F +++ Y Sbjct: 483 SNLVSRLNSWENHRTESEHNNSLIV-KIFAFQMVNTY 518 >Z81030-2|CAB02704.2| 343|Caenorhabditis elegans Hypothetical protein C01G10.2 protein. Length = 343 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +1 Query: 313 KYFGAKIIKMYHFIK*SIRIFIWHQISDNCKHNFQYSCIY 432 + F ++++ H + S R+ W+ S N K+NF S ++ Sbjct: 235 RLFSSRLVVFNHGLVFSARVSHWNNFSFNSKYNFNSSNLF 274 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,114,627 Number of Sequences: 27780 Number of extensions: 265546 Number of successful extensions: 472 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 472 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1385109898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -