BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0629 (615 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 25 0.38 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 25 0.67 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 25.4 bits (53), Expect = 0.38 Identities = 14/47 (29%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 247 CYRGPVAPGQPAPLVQIIVNVNQPGADAAI-IPQPVIVDESDEVKPD 384 CYR PG I+VN PG + + VI+D + + D Sbjct: 83 CYREDCIPGDGNKRSIIVVNRKMPGPSVEVCLGDEVIIDVVNHLSSD 129 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 24.6 bits (51), Expect = 0.67 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +1 Query: 280 APLVQIIVNVNQPGADAAIIPQPVIVDESDE 372 A +V +I N+ PG+D P P + +E Sbjct: 400 AAIVHLIANLPSPGSDQRSTPSPRVYGNVNE 430 Score = 21.0 bits (42), Expect = 8.2 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = -3 Query: 139 FVQMLEKESSGGWVCAGAVDSVQNGLQL 56 F+++ ++ + +VC + S Q GLQL Sbjct: 333 FLEIDDQGTVESFVCVNTLVSEQEGLQL 360 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,495 Number of Sequences: 336 Number of extensions: 2134 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15666150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -