BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0629 (615 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 24 1.0 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 22 4.1 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 24.2 bits (50), Expect = 1.0 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 206 PDGGAVTEPIVPSPVIVDQ 262 P GG++ P+ P+P V Q Sbjct: 151 PRGGSLPTPVTPTPTTVQQ 169 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 22.2 bits (45), Expect = 4.1 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = -1 Query: 345 LGNDSCISAWLVHVHNDLNERSGLAWCDWSTITGEGTIGSV 223 L ND + L + D ++ STI EG +GS+ Sbjct: 98 LANDFMKNLELTQIRRDRGLHVSCSFSAGSTIIREGDVGSI 138 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,195 Number of Sequences: 438 Number of extensions: 2657 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18215697 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -