BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0625 (677 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14886| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_17538| Best HMM Match : Iso_dh (HMM E-Value=0) 29 4.6 SB_1072| Best HMM Match : Tektin (HMM E-Value=2.5) 28 8.0 >SB_14886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1028 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 76 LM*VRSICVVHYKFYFCFCTMATLPG 153 L+ V IC VH FY+C C +++ G Sbjct: 55 LVAVLRICSVHLDFYYCTCVWSSMAG 80 >SB_17538| Best HMM Match : Iso_dh (HMM E-Value=0) Length = 644 Score = 28.7 bits (61), Expect = 4.6 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 33 VTRKCISLVSPYFNIDVSQIDL 98 + KC L+SPY ++D+ DL Sbjct: 13 IAAKCTQLISPYLDLDIKYFDL 34 >SB_1072| Best HMM Match : Tektin (HMM E-Value=2.5) Length = 465 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/41 (29%), Positives = 26/41 (63%) Frame = +3 Query: 450 RKNRRDRSNQTK*STKHRGIARTKTRLNLSIIKDHVRSIEQ 572 R+ ++ + Q + + K+ +A K + NL+ I+DH+R +E+ Sbjct: 354 RERCKEMAEQAEAAYKNVTLAEQKIKANLNDIRDHLRIMEE 394 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,054,532 Number of Sequences: 59808 Number of extensions: 323876 Number of successful extensions: 570 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 569 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -